KEGG   Escherichia coli NA114 (UPEC): ECNA114_2996
Entry
ECNA114_2996      CDS       T01998                                 

Gene name
yqgE
Definition
(GenBank) hypothetical protein
  KO
K07735  putative transcriptional regulator
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ena03000]
    ECNA114_2996 (yqgE)
Transcription factors [BR:ena03000]
 Prokaryotic type
  Other transcription factors
   Others
    ECNA114_2996 (yqgE)
SSDB
Motif
Pfam: DUF179
Other DBs
NCBI-ProteinID: AEG37835
Position
3077888..3078451
AA seq 187 aa
MNLQHHFLIAMPALQDPIFRRSVVYICEHNTNGAMGIIVNKPLENLKIEGILEKLKITPE
PRDESIRLDKPVMLGGPLAEDRGFILHTPPSNFASSIRISDNTVMTTSRDVLETLGTDKQ
PSDVLVALGYASWEKGQLEQEILDNAWLTAPADLNILFKTPIADRWREAAKLIGVDILTM
PGVAGHA
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaatttacagcatcactttcttattgccatgcctgctctccaggatccgattttccgt
cgttccgtggtctacatttgcgaacataataccaatggtgcaatggggatcatcgtcaac
aagccgctggaaaatctcaaaattgaagggattctggaaaagctgaagatcacgccggag
ccgcgtgatgaatcaatccgtctggataaaccggttatgctcggcggccctctggctgaa
gatcgcgggtttattttgcatactccgccctccaattttgcttccagcattcgcatttca
gacaacacggtgatgaccacttcccgcgatgtgctggaaacgctcggcaccgataaacaa
ccgtctgacgtattggtggctctgggctatgcctcctgggagaaaggtcaactggaacaa
gaaattctcgataacgcgtggctaacggccccggcggatctgaatattctgttcaaaaca
ccgattgccgaccgctggcgcgaggcggcaaaactgattggtgtggatattctcaccatg
cctggtgtggcagggcacgcctga

DBGET integrated database retrieval system