KEGG   Escherichia coli NA114 (UPEC): ECNA114_2997
Entry
ECNA114_2997      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K07447  putative holliday junction resolvase [EC:3.1.-.-]
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECNA114_2997
Enzymes [BR:ena01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     ECNA114_2997
SSDB
Motif
Pfam: RuvX
Other DBs
NCBI-ProteinID: AEG37836
Structure
PDB: 
1NU0 1NMN 1OVQ

Position
3078451..3078867
AA seq 138 aa
MSGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNLIERLLKEWQPDEIIVG
LPLNMDGTEQPLTARARKFANRIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK
VDSASAVIILESYFEQGY
NT seq 417 nt   +upstreamnt  +downstreamnt
atgagtggaaccttactcgccttcgacttcggtaccaaaagcattggtgtagcggtcggc
caacgcattaccggcaccgctcgcccattgcctgcaattaaagcacaggacggtacgccg
gactggaacctcatcgaacgtttactgaaagagtggcagccggacgaaatcatcgtcggt
ttgccgctgaatatggacggcaccgagcaaccattgactgccagagcgcgtaaatttgcc
aaccgtattcatggccgtttcggtgttgaagtaaagctccatgacgagcgtcttagcacc
gtggaggcacgttccggtctgtttgaacagggcggctatcgggcgctcaacaaaggcaaa
gttgactctgcctctgcggttatcattctcgaaagttatttcgagcagggatattaa

DBGET integrated database retrieval system