KEGG   Escherichia coli NA114 (UPEC): ECNA114_2998
Entry
ECNA114_2998      CDS       T01998                                 

Gene name
yggR
Definition
(GenBank) putative transport protein
  KO
K02669  twitching motility protein PilT
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ena02044]
    ECNA114_2998 (yggR)
   02035 Bacterial motility proteins [BR:ena02035]
    ECNA114_2998 (yggR)
Secretion system [BR:ena02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   ECNA114_2998 (yggR)
  Type IVa pilus homolog protein
   ECNA114_2998 (yggR)
Bacterial motility proteins [BR:ena02035]
 Pilus system
  Twitching motility proteins
   ECNA114_2998 (yggR)
SSDB
Motif
Pfam: T2SSE AAA_22 FtsK_SpoIIIE AAA_29 AAA_30 AAA_16 TrwB_AAD_bind AAA_14 AAA_23 ABC_tran AAA_19 DUF87 DUF853 Zeta_toxin Kinesin SRP54 ResIII DUF2075 AAA_7 CbiA
Other DBs
NCBI-ProteinID: AEG37837
Position
complement(3078982..3079863)
AA seq 293 aa
MEAAPFDAPDVEELLREWLDDDQRTILLENGQLDFAVSLAENQRLRGSAFAQRQGISLAL
RLLPSHCPQLEQLGAPPVLPELLKSENGLILVTGATGSGKSTTLAAMVGYLNQHADAHIL
TLEDPVEYLYASQRCLIQQREIGLHCMTFASGLRAALREDPDVILLGELRDSETIRLALT
AAETGHLVLATLHTRGAAQAVERLVDSFPAQEKDPVRNQLAGSLRAVLSQKLEVDKQEGR
VALFELLINTPAVGNLIREGKTHQLPHVIQTGQQVGMLTFQQSYQQRVGEGRL
NT seq 882 nt   +upstreamnt  +downstreamnt
atggaagctgcgccgtttgatgcgccggacgtcgaagagctactgcgggagtggctggat
gacgatcagcggacaatattgctggagaatggtcagttggattttgctgtgtcgctggcg
gaaaaccagcggttgcgtggcagtgcgttcgcgcaacggcaaggtatttctctggcatta
cggttgttaccttcgcactgtccacagctcgaacagcttggtgcgccaccggtattgccg
gaattactcaagagcgagaatggcctgattctggtgacgggggcgacggggagcggcaaa
tctaccacgctggcggcgatggttggctatctcaatcaacatgccgatgcgcatattctg
acgctggaagatcctgttgaatatctctatgccagccagcgatgtttgatccagcagcgg
gaaattggtttgcactgtatgacgttcgcatcgggattgcgtgccgcattgcgggaagat
cccgatgtgatattgctcggagagctgcgtgacagcgagacaatccgtctggcactgacg
gcggcagaaaccgggcatttggtgctggcaacattacatacgcgtggtgcggcgcaggca
gttgagcggctggtggattcatttccggcgcaggaaaaagatcccgtacgtaatcaactg
gcggggagtttacgggcagtgttgtcacaaaagctggaagtggataaacaggaaggacgc
gtggcgctgtttgaattactgattaacactcccgcggtggggaatttgattcgcgaaggg
aaaacccaccagttaccgcatgttattcaaaccgggcagcaggtggggatgttaacgttt
cagcagagttatcagcagcgggtgggggaagggcgtttgtga

DBGET integrated database retrieval system