KEGG   Escherichia coli NA114 (UPEC): ECNA114_2999
Entry
ECNA114_2999      CDS       T01998                                 

Gene name
yggS
Definition
(GenBank) hypothetical protein
  KO
K06997  PLP dependent protein
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    ECNA114_2999 (yggS)
SSDB
Motif
Pfam: Ala_racemase_N
Other DBs
NCBI-ProteinID: AEG37838
Structure
PDB: 
3SY1 1W8G

Position
3079980..3080684
AA seq 234 aa
MNDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQ
EGVDKIRHFQELGVTGLEWHFIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAEL
PPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRLRGLMAIPAPESEYVRQFEVA
RQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYSKK
NT seq 705 nt   +upstreamnt  +downstreamnt
atgaacgatattgcgcataacctggcacaggtccgggacaaaatctcagcggctgcaacg
cgttgcggccgttctccagaagaaattacgctgcttgcagtcagtaaaacaaaacctgcg
agcgccatcgcagaagccattgatgccgggcagcgtcaatttggtgaaaactacgttcag
gaaggggtagataaaattcgccactttcaggaactgggcgtaacaggattagaatggcat
tttattggcccgttgcagtctaataaaagccgcctggtggcagagcatttcgactggtgt
cataccatcgaccgtttgcgcattgctacccgcctcaacgatcagcgcccggcagaactt
ccccctcttaacgtactgattcaaattaatattagtgacgaaaacagtaagtccgggatt
caactggcagaactggacgagctggcagctgcggtcgctgaactaccgcgtttacgtctg
cgcgggctgatggcaatccctgcacctgagtcagaatatgtaaggcagtttgaagttgca
cgccaaatggctgtagcatttgccggactgaaaacgcgctacccgcatatcgacacgctc
tctctgggaatgtcggacgatatggaagccgccattgcggcaggtagcacgatggttcgt
atcggcactgcaatttttggtgcgcgtgattactctaaaaaataa

DBGET integrated database retrieval system