KEGG   Escherichia coli NA114 (UPEC): ECNA114_3000
Entry
ECNA114_3000      CDS       T01998                                 

Gene name
yggT
Definition
(GenBank) hypothetical protein
  KO
K02221  YggT family protein
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ena02044]
    ECNA114_3000 (yggT)
Secretion system [BR:ena02044]
 Type II secretion system
  Type IVa pilus homolog protein
   ECNA114_3000 (yggT)
SSDB
Motif
Pfam: YGGT
Other DBs
NCBI-ProteinID: AEG37839
Position
3080702..3081268
AA seq 188 aa
MNTLTFLLSTVIELYTMVLLLRIWMQWAHCDFYNPFSQFVVKVTQPIIGPLRRVIPAMGP
IDSASLLVAYILSFIKAIVLFKVVTFLPIIWIAGLLILLKTIGLLIFWVLLVMAIMSWVS
QGRSPIEYVLIQLADPLLRPIRRLLPAMGGIDFSPMILVLLLYVINMGVAEVLQATGNML
LPGLWMAL
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaatacgttgactttcctgctttcaacggtcattgagctgtataccatggtgctgtta
ttacgcatctggatgcagtgggctcattgtgatttttacaaccccttctcacagtttgta
gtgaaggtaacgcagccaattatcgggccactgcgccgcgttattccggcaatggggccc
attgacagcgcctcactgctggttgcgtacattctcagtttcatcaaagccatcgtgctg
tttaaagtggtgaccttcctgccaatcatctggattgccggtttactgattctgctgaaa
accatcggcctgctgattttctgggtcctgctggtgatggcgattatgagctgggtaagc
caggggcgtagcccgattgaatacgtgctgattcagctggccgatccgctgctgcgcccg
attcgccgcctgctaccggcaatgggtgggattgatttctcgccgatgatcctcgttctg
ctgctgtatgtcatcaatatgggtgtcgcagaagtcttgcaggcgaccggaaatatgctg
ctgccggggctgtggatggcgttatga

DBGET integrated database retrieval system