KEGG   Escherichia coli NA114 (UPEC): ECNA114_3001
Entry
ECNA114_3001      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K09131  uncharacterized protein
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECNA114_3001
SSDB
Motif
Pfam: DUF167
Other DBs
NCBI-ProteinID: AEG37840
Structure
PDB: 
1YH5 1N91

Position
3081265..3081555
AA seq 96 aa
MSAVTVNDGGLVLRLYIQPKASRDSIVGLHGDEVKVAITAPPVDGQANSHLVKFLGKQFR
VAKSQVVIEKGELGRHKQIKIINPQQIPPEIAALIN
NT seq 291 nt   +upstreamnt  +downstreamnt
atgagtgccgtaacagtgaatgatggcggtctggttttacggctctatattcagccgaaa
gccagccgtgattctattgtcggtttacatggcgacgaggtaaaagtcgccattaccgcg
ccgccggttgacggccaggccaacagccatctggtgaagtttctcggtaagcaattccgg
gttgccaaaagccaggtggtgattgaaaaaggcgaacttggccgccacaaacaaattaaa
atcattaatccgcaacaaatcccgccagaaatcgcggcgttaattaattag

DBGET integrated database retrieval system