KEGG   Escherichia coli NA114 (UPEC): ECNA114_3002
Entry
ECNA114_3002      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00230  Purine metabolism
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECNA114_3002
Enzymes [BR:ena01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     ECNA114_3002
SSDB
Motif
Pfam: Ham1p_like
Other DBs
NCBI-ProteinID: AEG37841
Structure
PDB: 
1K7K 2Q16 2PYU

Position
3081563..3082156
AA seq 197 aa
MQKVVLATGNAGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV
TGLPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQRQARFHC
VLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREEKSAI
SHRGQALKLLLDALRNG
NT seq 594 nt   +upstreamnt  +downstreamnt
atgcaaaaagttgtcctcgcaaccggcaatgccggtaaagtgcgtgagctggcgtcgctg
cttagcgacttcggtcttgatatcgtggcccaaacagacctcggtgtagattccgctgaa
gaaactggcctgacctttatcgaaaacgcgattctgaaagcgcgccatgcggcaaaagtg
accggtttaccggcaattgccgacgactccggtctggcggtagatgtacttggcggtgca
ccggggatttactccgcgcgttattccggtgaagacgcgaccgatcaaaagaatctgcaa
aaactgctggaaacaatgaaagacgtaccggacgaccaacgtcaggcgcgtttccactgc
gtgctggtatatctgcgtcacgcggaagatcccactccgctggtgtgccacggtagctgg
ccgggcgtgattactcgtgaaccagcgggcactggtggctttggttatgatccaatcttc
tttgttccttccgaagggaaaaccgctgccgaactgacccgcgaagaaaagagcgccatt
tcccaccgtggtcaggcattgaaactgctgctggacgctttacgtaatggttaa

DBGET integrated database retrieval system