KEGG   Escherichia coli NA114 (UPEC): ECNA114_3003
Entry
ECNA114_3003      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: Radical_SAM HemN_C Fer4_14 Fer4_12
Other DBs
NCBI-ProteinID: AEG37842
Position
3082149..3083285
AA seq 378 aa
MVKLPPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLNDLDNDVAYAQGREVQ
TIFIGGGTPSLLSGPAMQTLLDGVRARLPLAADAEITMEANPGTVEADRFVDYQRAGVNR
ISIGVQSFSEEKLKRLGRIHGPQEAKRAAKLASGLGLRSFNLDLMHGLPDQSLEEALGDL
RQAIELNPPHLSWYQLTIEPNTLFGSRPPVLPDDDALWDIFEQGHQLLTAAGYQQYETSA
YAKPGYQCQHNLNYWRFGDYIGIGCGAHGKVTFPDGRILRTTKTRHPRGFMQGRYLESQR
DVEAADKPFEFFMNRFRLLEAAPRVEFIQYTGLSEEVIRSQLDEAIAQGYLTECADYWQI
TEHGKLFLNSLLELFLAE
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggttaaattaccgccgctgagtctctacattcacatcccgtggtgcgtgcagaaatgc
ccgtactgcgatttcaactctcacgcgttgaaaggagaagtgccgcacgacgattatgtt
cagcatctgcttaacgatctggacaacgatgtggcttacgctcagggccgtgaagtgcag
acaatctttattggcggtggtacgccgagcctgctttccggcccggcgatgcaaacgctg
ctggacggcgtgcgtgcgcgtttgccgctggcagcggatgcagaaattactatggaagcg
aacccaggcacggtagaagcggatcgctttgtcgattatcagcgtgctggtgtgaaccgc
atctctattggtgtgcagagttttagcgaagaaaagctgaaacgactcgggcgtattcat
ggcccgcaagaagcgaaacgagcggcaaagctggcgagcggtttagggttacgtagtttt
aaccttgatttgatgcatgggctgccggatcaatcactggaagaggcgctaggcgatctg
cgccaggctattgaactgaatccgccacatctttcctggtatcaactgaccatcgaacct
aatacgctgtttggctcgcgccctcctgtactgccggacgatgacgcgctgtgggatatt
ttcgaacaggggcatcagttattaaccgcagcgggctatcagcagtatgaaacatccgct
tacgccaaacccggttatcagtgccagcacaatctcaactactggcgatttggcgactac
atcggtattggctgcggcgcgcacggcaaagtgaccttcccggatgggcgcattctgcgt
accaccaaaacgcgtcatccgcgtggttttatgcagggaagatatctggaaagccagcgt
gatgtcgaagctgcagataaaccgtttgagttctttatgaatcgcttccgtctgctggaa
gccgcgccgcgcgtggagtttatccaatatactggcctttctgaagaagttattcgctct
cagttagacgaggccatcgctcaaggttatctcacagaatgtgcggattactggcagata
accgagcatggtaaattattcttaaactcacttcttgaattattcctcgctgagtaa

DBGET integrated database retrieval system