KEGG   Escherichia coli NA114 (UPEC): ECNA114_3004
Entry
ECNA114_3004      CDS       T01998                                 

Definition
(GenBank) putative TRAP-type C4-dicarboxylate transport system,periplasmic protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: DctP
Other DBs
NCBI-ProteinID: AEG37843
Position
3083600..3084586
AA seq 328 aa
MKMRSFTRSLVCASLLALVSTGVNAAEKVTLKLAHNLERSHVVHQSFEELAKEVKQLSKG
NMVIRIYPSSQMGNARETMELLQNGALDMTKGSASDLESFDNIYAIYNLPFLFKDQAHFN
KVVFGEVGEEIMDSTKDKGFFALSAYVAGTRSFYAKKPITKPEDLKGLKIRVQPSPTTIK
MIELMGGSPTPISFGEVYTAMQQGVVDGAENNVPSWVQTRHIEIAKVFSEDEHASIPDFL
VISTKTWNKLTPEQQQILETAAKKSEADQQKLWEKIDADTRAQAKAMGGEIVKVDKAPFR
AAVQPLFDDFKKDPKQAALLEKFDNAAQ
NT seq 987 nt   +upstreamnt  +downstreamnt
atgaaaatgaggtcatttacccgctcattagtctgcgcatccttgctggctctggttagc
actggcgtaaacgccgcagaaaaagtgacgttaaagttagcacacaacctggaaagaagt
catgttgtacatcagagttttgaagagctggcgaaagaggtaaaacagctgtcaaaaggt
aatatggtgatccgtatttatcccagcagccagatgggtaatgcgcgagaaactatggag
ttgttgcaaaatggtgcactggatatgaccaaaggttccgccagtgatctggagtctttt
gataatatttatgctatctataatttgccgttcttatttaaagatcaggcgcacttcaac
aaagtggtttttggtgaagttggtgaagaaattatggattcaacaaaagataaaggcttt
tttgctttatcagcttatgtagcgggtacacgcagtttctatgcgaaaaaaccgattact
aagccagaagatcttaaagggctgaaaattcgtgttcagccaagcccgaccaccatcaaa
atgattgaactgatgggtggctcacccactccaatttcatttggcgaagtttatactgcg
atgcagcaaggtgtagtagatggcgcagaaaataacgtgccttcctgggtgcagactaga
catatcgaaattgccaaagtcttttctgaagatgaacatgcctcaattcctgactttttg
gttatctccaccaaaacatggaataaattaaccccagaacagcaacaaatcctcgaaaca
gcggcgaagaaatccgaagctgatcaacaaaaattgtgggaaaaaattgacgctgacaca
cgtgctcaggcgaaagctatgggtggtgaaatcgttaaggttgataaagccccattccgt
gccgcagttcaacctctgtttgacgacttcaaaaaagatccaaaacaagctgctttgtta
gagaaattcgacaacgctgctcaataa

DBGET integrated database retrieval system