KEGG   Escherichia coli NA114 (UPEC): ECNA114_3005
Entry
ECNA114_3005      CDS       T01998                                 

Definition
(GenBank) putative TRAP-type transport system, small permease component-N-acetylneuraminate transporter protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: DctQ DUF2768 Abhydrolase_9_N
Other DBs
NCBI-ProteinID: AEG37844
Position
3084631..3085134
AA seq 167 aa
MIFNRLKLAVDRVIAAFSVAVMLALVVCVVWQVFSRYVLNQPSTLTDELARFLMIWVGLL
GAAYTVGAQRHLSIDLFALALNKRKQLLLSIVINVLILGFAGSVIVTGGLKLIDKTLATS
QVSAAMQIPMGYVYIILPLSGLVMMFYALCFINQSIQQLKQPAQEAS
NT seq 504 nt   +upstreamnt  +downstreamnt
atgatatttaaccgcctgaaacttgcggtagaccgcgtcattgccgcgttttctgtcgcc
gtaatgcttgctctggttgtatgcgtagtctggcaagtatttagccgctacgtacttaac
cagccaagtacattaaccgatgagctggcacgctttttgatgatctgggtaggattatta
ggtgctgcatataccgtcggcgcgcagagacatctctctatcgatttatttgctctcgcc
ctgaataagcgcaagcaattacttcttagtatagtcattaacgttcttattttaggtttt
gccggttcggttattgtgactggtggcctgaaattaattgataaaacactggcaacatca
caggtatctgccgcgatgcaaataccgatgggatacgtatatatcattctgccattaagt
ggattggtgatgatgttttatgccttgtgttttattaatcaaagcattcaacaactgaaa
caacctgcgcaggaggccagttaa

DBGET integrated database retrieval system