KEGG   Escherichia coli NA114 (UPEC): ECNA114_3006
Entry
ECNA114_3006      CDS       T01998                                 

Definition
(GenBank) putative TRAP-type C4-dicarboxylate transport system,large permease
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: DctM CitMHS
Other DBs
NCBI-ProteinID: AEG37845
Position
3085134..3086435
AA seq 433 aa
MDSYIALTLFGCFFVLVFIGVPISFSIGIATVASMLLMFPWDIAAITVSQRLANGLDNFA
LLAIPFFIFAGTLMNSGGIAIRLINLAQVMVGRVPGSLGHVNVLANMMFGSISGSAVAAA
AAVGGTLNPIQTKEGYDPAFSTAVNVSSCITGLLIPPSNVLIVFSLTAGGVSVASLFMAG
YLPGILMGLAVMIVCGIIAKRRGYPLSERATFAQACKAFLDALPSLLLVFIVMGGILGGI
FTATEASAIAVVYTFILSVLIYREVKWRDLPKLILESVVTTSIVLLLIGFSVGMSWAMTN
ADIPYMISDALMGISDNPLVILLLINIVLLIVGIFMDMTPAVLIFTPIFLPIAQELGMDP
VHFGIMMVANLCIGLLTPPVGSALFVGCSISGVKIQHLIKPLLPFYAALLITLMMITYIP
QISLFIPQLLGLM
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggatagttatatcgcgcttacactgtttggctgtttttttgtgctggtctttattggt
gtgcccatttcgttctcaatcggtattgccactgtagcttcaatgctgttgatgtttccc
tgggatatcgcggcaatcactgtttcgcagcgactggctaatggactggataactttgcc
ctattggcaatcccctttttcatctttgccggaacgctgatgaacagcggcggtattgcg
atacgtttgattaacctcgcccaggtaatggttggccgcgttcctggttcgcttggtcat
gtgaacgtcctggcgaatatgatgtttggttccatttctggttcagctgttgcggcagct
gctgccgttggtggcacactgaatcccattcagaccaaagaaggttatgatccggcattt
tctaccgctgtaaacgtctcatcttgtattactggattactgataccgccctcaaacgtg
ttaattgtgttttccctgacagctggcggcgtttctgtagcatcgctatttatggcggga
tatttgccagggatcttaatgggtctcgcggtaatgatagtctgcggcattattgctaaa
cgccgtggctacccactttcagaaagagcaacctttgctcaggcatgtaaagcgtttctg
gatgccttaccaagtttgcttctggtgttcattgtaatgggcggcattctgggcggcatt
tttaccgcaactgaagcgtcagcaattgccgttgtctacacatttattctctcggtgctg
atttaccgggaagtaaaatggcgcgatttacccaaactgattctggaatcggttgttacc
acttcgattgtattactgttgatcggtttttccgtgggcatgtcctgggcaatgaccaat
gctgatattccttatatgatcagcgacgcgttgatggggatttctgataacccactggtc
atattgctgctgattaatatcgtcttattaattgtcggcatctttatggacatgacaccg
gctgtactaatcttcacaccaatcttcttgccgattgcacaagagctgggaatggatccg
gtacatttcggtattatgatggtggccaacctttgtattgggctgttaacaccgccggtg
ggtagtgcgctatttgttggttgttctatttcaggtgtgaagattcaacatttgatcaaa
ccattgctgccattttatgccgcattgttaatcacgttgatgatgatcacttacatcccg
caaatatccttgttcattccacagctactagggctaatgtaa

DBGET integrated database retrieval system