KEGG   Escherichia coli NA114 (UPEC): ECNA114_3007
Entry
ECNA114_3007      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: DUF1202 Malectin APG6_N
Other DBs
NCBI-ProteinID: AEG37846
Position
complement(3086491..3087498)
AA seq 335 aa
MKKQWIVGTALLMLMTGNVWADGEPPTENILKDQFKKQYHGILKLDAITLKNLDAKGNQA
TWSAEGDVSSSDDLYTWVGQLADYELLEQTWTKDKPVKFSAMLTSKGTPASGWSVNFYSF
QAAASDRGRVVDDIKTNNKYLIVNSEDFNYRFSQLESALNNQKNSIPALEKEVKALDKQM
VAAQKAADAYWGKDANGKQMTREDAFKKIHQQRDEFNKQNDSEAFAVKYDKEVYQPAIAA
CHKQSEECYEVSIQQKRDFDINEQRRQTFLQSQKLSRKLQDDWITLEKGQYPLTMKVSEI
NSKKVAILMKIDDINQANERWKKDTEQLRRNGVIK
NT seq 1008 nt   +upstreamnt  +downstreamnt
gtgaaaaagcaatggattgttggcacggcgctgcttatgttgatgactggtaatgtctgg
gcagatggcgaaccgccaactgaaaatatcttaaaagatcaattcaaaaagcagtatcac
ggcattctcaagcttgatgctatcaccttaaaaaatcttgatgctaagggtaatcaggcc
acctggtcagcggaaggcgatgtctcttccagtgacgatctctatacctgggtcggtcag
ttggcagattacgaactgctcgaacagacctggacgaaagataaaccggtaaaattctcg
gcgatgttaaccagtaaaggaacgcccgcgtctggctggtcggtgaacttttactctttt
caggcggcagccagcgatcgtgggcgggtggtcgacgatatcaaaacgaataataaatat
ctgatcgtgaatagcgaagatttcaattatcgctttagtcagcttgagtctgcgttgaat
aaccagaagaactcgattcctgcgctggaaaaggaagtgaaagcgcttgataagcaaatg
gtggcggcgcagaaagcagcggatgcatattggggaaaagatgcaaacggtaagcaaatg
acccgcgaagacgcctttaaaaaaattcaccaacagcgtgatgagtttaataaacagaat
gatagcgaggcgttcgcggttaaatatgacaaagaggtttatcaaccggcgattgcggca
tgtcataaacagagtgaagagtgttatgaagtgtcgattcagcagaagcgagatttcgat
atcaacgaacaacggcgacagacttttctgcaatcacaaaaacttagccgtaaattgcag
gatgactggataacgctcgagaaagggcaatatccgttaacgatgaaagtttcagaaata
aacagtaaaaaagtcgcgattttgatgaaaattgacgatatcaatcaggctaatgaacgc
tggaaaaaagataccgaacaattgcggcgcaatggagtgattaagtaa

DBGET integrated database retrieval system