KEGG   Escherichia coli NA114 (UPEC): ECNA114_3008
Entry
ECNA114_3008      CDS       T01998                                 

Gene name
ansB
Definition
(GenBank) L-asparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00250  Alanine, aspartate and glutamate metabolism
ena00460  Cyanoamino acid metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECNA114_3008 (ansB)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ECNA114_3008 (ansB)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     ECNA114_3008 (ansB)
SSDB
Motif
Pfam: Asparaginase Asparaginase_C
Other DBs
NCBI-ProteinID: AEG37847
Structure
PDB: 

Position
complement(3087615..3088661)
AA seq 348 aa
MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTAGKVGVENLVNA
VPQLKDIANVKGEQVVNIGSQDMNDNVWLTLAKKINTDCDKTDGFVITHGTDTMEETAYF
LDLTVKCDKPVVMVGAMRPSTSMSADGPFNLYNAVVTAADKASANRGVLVVMNDTVLDGR
DVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQRTPARKHTSDTPFDVSKLNELPKVGIVY
NYANASDLPAKALVDAGYDGIVSAGVGNGNLYKTVFDTLATAAKNGTAVVRSSRVPTGAT
TQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggagtttttcaaaaagacggcacttgccgcactggttatgggttttagtggtgcagca
ttggcattacccaatatcaccattttagcaaccggcgggaccattgccggtggtggtgac
tccgcaaccaaatctaactacacagcgggtaaagttggcgtagaaaatctggttaatgcg
gtgccgcaactgaaggacattgcgaacgttaaaggcgagcaggtagtgaatatcggctcc
caggacatgaacgataatgtctggctgacactggcgaaaaaaattaacaccgactgcgat
aaaaccgacggcttcgtcattactcacggtaccgacacgatggaagaaaccgcttacttc
ctcgacctgacggtgaaatgcgacaaaccggtggtgatggtcggtgcaatgcgcccgtcc
acgtctatgagcgcagacggtccattcaacctgtataacgcggtagtgaccgcagctgat
aaagcctccgctaatcgtggcgtactggtggtgatgaacgacaccgtactggacggtcgc
gatgtcaccaaaaccaacaccaccgacgtagcgaccttcaagtctgttaactacggtcct
ctgggttacattcacaacggtaagattgactaccaacgtaccccggcacgtaagcacacc
agcgatacgccattcgatgtctctaagctgaatgagctgccgaaagtcggcatcgtttat
aactacgctaacgcatccgatcttccggctaaagcactggtagatgcgggctatgatggc
atcgtcagcgctggtgtgggtaacggcaacctgtataaaaccgtatttgacacccttgca
accgccgcgaaaaacggcactgcagtagtgcgttcttcccgtgtaccgacgggcgctacc
actcaggatgctgaagtggatgatgcgaaatacggcttcgtcgcctctggcacgctgaac
ccgcaaaaagcgcgcgtcctgctgcagctggctctgacgcaaaccaaagatccgcagcag
atccagcagatcttcaatcagtactaa

DBGET integrated database retrieval system