KEGG   Escherichia coli NA114 (UPEC): ECNA114_3009
Entry
ECNA114_3009      CDS       T01998                                 

Gene name
yggN
Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: DUF2884 NB-ARC
Other DBs
NCBI-ProteinID: AEG37848
Position
complement(3088837..3089556)
AA seq 239 aa
MMRKMLLAAALSVTAMTAHADYQCSVTPRDDVIVSPQTVQVKGENGNLVITPDGNVMYNG
KQYSLNAAQREQAKDYQAELRSTLPWIDEGAKSRVEKARIALDKIIVQEMGESSKMRSRL
TKLDAQLKEQMNRIIETRSDGLTFHYKAIDQVRAEGQQLVNQAMGGILQDSINEMGAKAV
LKSGGNPLQNVLGSLGGLQSSIQTEWKKQEKDFQQFGKDVCSRVVTLEDSRKALVGNLK
NT seq 720 nt   +upstreamnt  +downstreamnt
atgatgcgcaaaatgctgctggcggcagcactttcagtgacggcaatgaccgctcacgcc
gactaccagtgcagcgtcacgccgcgtgacgatgtgattgtcagcccgcaaaccgtgcag
gtgaagggcgaaaacggcaatctggtgatcacgccagacggcaacgtgatgtataacggt
aagcaatattccctgaacgccgcccagcgcgagcaggcgaaggattatcaggctgaactg
cgtagcaccctgccgtggattgatgaaggcgcgaaaagccgcgtcgagaaagcccgtatt
gcgctggataaaattatcgttcaggagatgggcgaaagcagcaaaatgcgcagccgtctg
accaaacttgatgcgcagctgaaagagcagatgaaccgcattatcgaaacgcgcagcgat
ggcctgacgtttcactataaagccattgatcaggttcgcgccgaaggccagcaattagtg
aatcaggcaatgggcggaattttacaggacagcattaatgaaatgggcgcgaaagcggtg
ctgaaaagcggtggtaacccattacagaatgtgctgggaagcctgggcggtctgcaatcc
tcaatccaaaccgaatggaaaaagcaggaaaaagatttccagcagtttggcaaagatgtt
tgtagccgcgttgtgactctggaagatagtcgcaaagccctggtcgggaatttaaaataa

DBGET integrated database retrieval system