KEGG   Escherichia coli NA114 (UPEC): ECNA114_3011
Entry
ECNA114_3011      CDS       T01998                                 

Gene name
yggL
Definition
(GenBank) hypothetical protein
  KO
K09923  uncharacterized protein
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECNA114_3011 (yggL)
SSDB
Motif
Pfam: DUF469
Other DBs
NCBI-ProteinID: AEG37850
Position
complement(3089740..3090066)
AA seq 108 aa
MAKNRSRRLRKKMHIDEFQELGFSVAWRFPEGTSEEQIDKTVDDFINEVIEPNKLAFDGS
GYLAWEGLICMQEIGKCTEEHQAIVRKWLEERKLGEVRTSELFDVWWD
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcaaagaaccgtagccgtcgtctgcgtaaaaaaatgcacatcgacgaattccaggaa
ttaggattttcggtggcatggcgattcccggaaggtacatcggaagaacagattgataaa
accgttgatgactttattaacgaggttatcgaaccgaacaaactggcctttgacggcagc
ggttatctggcctgggaaggtctgatctgcatgcaggaaatcggcaaatgcaccgaagaa
catcaggcgattgtgcgtaagtggctggaagagcgcaaactgggcgaggtacgcaccagc
gaacttttcgacgtttggtgggactaa

DBGET integrated database retrieval system