KEGG   Escherichia coli NA114 (UPEC): ECNA114_3089
Entry
ECNA114_3089      CDS       T01998                                 

Gene name
metC
Definition
(GenBank) Cystathionine beta-lyase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00270  Cysteine and methionine metabolism
ena00450  Selenocompound metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01230  Biosynthesis of amino acids
Module
ena_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECNA114_3089 (metC)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_3089 (metC)
Enzymes [BR:ena01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     ECNA114_3089 (metC)
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5
Other DBs
NCBI-ProteinID: AEG37928
Structure
PDB: 

Position
3169545..3170732
AA seq 395 aa
MADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANGELFYGRRG
TLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFVEQGDHVLMTNTAYEPSQDFCSK
ILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDA
IIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLM
GQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFW
KRDFTGSSGLFSFVLKKKLNDEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRP
QGKIDFSGTLIRLHIGLEDVDDLIADLDAGFARIV
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcggacaaaaagcttgatactcaactggtgaatgcaggacgcagcaaaaaatacacg
ctcggtgcggtaaatagcgtgattcagcgcgcgtcttcgctggtctttgacagtgtggaa
gccaaaaaacacgcgacacgtaatcgcgccaatggcgagttgttctatggacggcgtgga
acgttaacccatttctccttacaacaagcgatgtgtgaactggaaggtggcgcaggctgt
gtgctatttccctgcggggcggcagcggttgctaattccattcttgcttttgtcgaacag
ggcgatcatgtgttgatgaccaacaccgcctatgaaccgagtcaggatttctgtagcaaa
atcctcagcaaactgggcgtaacgacatcgtggtttgatccgctgattggtgccgatatc
gttaagcatctgcagccaaacactaaaatcgtgtttctggaatcgccaggttccatcacc
atggaagtccacgatgttccggcgattgttgccgccgtacgcagtgtggtcccggatgcc
atcattatgatcgacaacacctgggcagccggtgtgctgtttaaggcgctggattttggc
atcgatgtttctattcaggccgccaccaaatatctggttgggcattcagatgcgatgatt
ggcactgcggtgtgcaatgcccgttgctgggagcagctgcgagagaatgcctatctgatg
ggccagatggtcgatgccgataccgcctatataaccagccgtggcctgcgcacattaggt
gtgcgtttgcgccaacatcatgaaagcagtctgaaagtggctgaatggctggcagaacat
ccccaagtagcgcgagttaaccaccctgctctgcctggcagtaaaggccacgaattctgg
aaacgagactttacaggcagcagcgggctattttcctttgtgcttaagaaaaaactcaat
gatgaagagctggcgaactatctggataacttcagtttattcagcatggcctactcgtgg
ggcgggtatgaatcgttgatcctggcaaatcaaccagaacatatcgccgccattcgccca
caaggcaagatcgattttagcgggaccttgattcgcctgcatattggtctggaagatgtc
gacgatctgattgccgatctggacgccggttttgcgcgaattgtataa

DBGET integrated database retrieval system