KEGG   Escherichia coli NA114 (UPEC): ECNA114_3744
Entry
ECNA114_3744      CDS       T01998                                 

Gene name
selA
Definition
(GenBank) Selenocysteine synthase
  KO
K01042  L-seryl-tRNA(Ser) seleniumtransferase [EC:2.9.1.1]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00450  Selenocompound metabolism
ena00970  Aminoacyl-tRNA biosynthesis
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_3744 (selA)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECNA114_3744 (selA)
Enzymes [BR:ena01000]
 2. Transferases
  2.9  Transferring selenium-containing groups
   2.9.1  Selenotransferases
    2.9.1.1  L-seryl-tRNASec selenium transferase
     ECNA114_3744 (selA)
SSDB
Motif
Pfam: SelA Se-cys_synth_N Aminotran_5 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AEG38584
Position
complement(3847660..3849051)
AA seq 463 aa
MTTETRSLYSQLPAIDRLLRDSSFLSLRDTYGHTRVVELLRQMLDEAREVIRDSQTLPAW
CENWAQEVDARLTKEAQSALRPVINLTGTVLHTNLGRALQAEAAVEAVTKAMRSPVTLEY
DLDDAGRGHRDRALAQLLCRITGAEDACIVNNNAAAVLLMLAATASGKEVVVSRGELVEI
GGAFRIPDVMRQAGCTLHEVGTTNRTHANDYRQAVNENTALLMKVHTSNYSIQGFTKAID
EAELVALGKELDVPVVTDLGSGSLVDLSQYGLPKEPMPQELIAAGVSLVSFSGDKLLGGP
QAGIIVGKKEMIARLQSHPLKRALRADKMTLAALEATLRLYLHPEALSEKLPTLRLLTRS
AEVIQIQAQRLQALLAAHYGAEFAVQVMPCLSQIGSGSLPVDRLPSAALTFTPHDGRGSH
LESLAARWRELPVPVIGRIYDGRLWLDLRCLEDEQRFLEMLLK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgacaaccgaaacgcgttccctctatagtcaacttccggctattgatcgcttattgcgc
gatagctccttcctttctttgcgtgatacttatggtcacacccgcgtggtggaattgctg
cgtcagatgcttgacgaagcgcgagaagtgattcgtgacagccagacgctgcccgcgtgg
tgtgaaaactgggcgcaagaagtcgatgcccggttgacgaaagaggcgcaaagcgcgctg
cgtccggtgatcaacctgacgggaaccgtgctgcataccaaccttgggcgagctttacag
gcggaagccgcggtggaagccgttacgaaggctatgcgttcgccagtgaccctcgagtac
gatctggacgacgccggacgtggacatcgcgatcgggcgctggcgcagctgctgtgccgt
attacgggggcggaagatgcctgtatcgttaataacaatgcggcggcggtgttattgatg
ttggcggccactgccagcgggaaagaggtggtggtttctcgcggcgaactggtggagatt
ggcggcgcgtttcgtattcccgatgttatgcgtcaggcaggatgcaccctacacgaagta
gggaccaccaaccgcacgcacgcgaatgattatcgtcaggcggtgaatgaaaataccgca
ctgttgatgaaagtacataccagtaactacagcattcaggggttcaccaaagcgatagat
gaagcggaactggtggcgctcggcaaagaactggatgttccagtggtgactgatttaggc
agtggctcgctggtcgatcttagccagtacggtttgccgaaagagccaatgccgcaggag
ttgattgcggcgggcgtcagtctggtgagcttctccggcgacaagctgttaggcgggccg
caggcaggaattattgttggtaaaaaagaaatgatcgcccgcctgcaaagccacccgctg
aagcgtgcattacgcgcggataaaatgaccctcgcggcgctggaagccacgttgcgtctt
tatttacaccctgaagctctgagtgaaaaattaccgaccctgcgcctgcttacccgcagc
gcagaggtcattcaaatccaggcacaacgtttacaggctctccttgccgcacattacggc
gcggagtttgcggtacaggttatgccatgtctttcgcagatcggcagtggttcgctgccg
gttgatcgcctgccgagcgcggcattaacgtttaccccccatgatggacgcggtagccac
cttgagtcattagccgcccgctggcgtgaattgccagtgccggtgattggtcgtatttat
gacggacgattgtggctggatttacgctgccttgaagatgagcaacggtttttggagatg
ttgttgaaatga

DBGET integrated database retrieval system