KEGG   Escherichia coli NA114 (UPEC): ECNA114_4078
Entry
ECNA114_4078      CDS       T01998                                 

Gene name
metB
Definition
(GenBank) Cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00270  Cysteine and methionine metabolism
ena00450  Selenocompound metabolism
ena00920  Sulfur metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01230  Biosynthesis of amino acids
Module
ena_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ECNA114_4078 (metB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECNA114_4078 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_4078 (metB)
Enzymes [BR:ena01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     ECNA114_4078 (metB)
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5
Other DBs
NCBI-ProteinID: AEG38922
Structure
PDB: 
1CS1

Position
4191094..4192254
AA seq 386 aa
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVL
FVDQSDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYL
LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAML
SFELDGDEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLL
RISTGIEDGEDLIADLENGFRAANKG
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgacgcgtaaacaggccaccatcgcagtgcgtagcgggttaaatgacgacgaacagtat
ggttgcgttgtccctcccatccatctttccagtacctataactttaccggatttaatgaa
ccacgtgcgcatgattactcgcgtcgcggcaacccaacgcgcgatgtggttcagcgtgcg
ctggcagaactggaaggcggtgccggtgccgtacttactaataccggcatgtccgcgatt
cacctggtaacgaccgtctttttgaaacctggcgatctgctggttgcgccgcacgactgc
tacggcggtagctatcgcctgttcgacagcctggcgaaacgcggttgctatcgcgtgttg
tttgttgatcaaagcgatgaacaggcattacgggcagcgctggcagaaaaacccaaactg
gtactggtagaaagcccaagtaatccattgttacgcgtcgtggatattgcgaaaatttgc
catctggcaagggaagtcggggcggtgagcgtggtggataacaccttcttaagcccggca
ttacaaaatccactggcattaggtgccgatctggtgttgcattcatgcacgaaatatctg
aacggtcactctgacgtggtggcaggcgtagtgattgctaaagacccggacgttgtcact
gaacttgcctggtgggcaaacaatattggcgtgacgggcggcgcgtttgacagctatctg
ctgctgcgcgggttgcgaacgctggtgccgcgtatggagctggcgcagcgcaacgcgcag
gcgattgtgaaatatctgcaaacccagccgttggtgaagaaactgtatcacccgtcgctg
ccggaaaatcaggggcatgaaattgccgcgcgccagcaaaaaggctttggcgcaatgttg
agttttgaactggatggcgatgagcagacgctgcgtcgtttcctgggcgggctgtcgttg
tttacgctggcggaatcattagggggagtggaaagtttaatctctcacgccgcaaccatg
acacatgcaggcatggcaccagaagcgcgtgctgccgccgggatctccgagacgctgctg
cgtatctccaccggtattgaagatggcgaagatttaattgccgacctggaaaatggcttc
cgggctgcaaacaaggggtaa

DBGET integrated database retrieval system