KEGG   Escherichia coli NA114 (UPEC): ECNA114_4121
Entry
ECNA114_4121      CDS       T01998                                 

Gene name
metE
Definition
(GenBank) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00270  Cysteine and methionine metabolism
ena00450  Selenocompound metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01230  Biosynthesis of amino acids
Module
ena_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECNA114_4121 (metE)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_4121 (metE)
Enzymes [BR:ena01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     ECNA114_4121 (metE)
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1
Other DBs
NCBI-ProteinID: AEG38965
Position
4244744..4247005
AA seq 753 aa
MTILNHTLGFPRVGLRRELKKAQESYWAGNSTREELLAVGRELRARHWDQQKQAGIDLLP
VGDFAWYDHVLTTSLLLGNVPQRHQNNDGSVDIDTLFRIGRGRAPTGEPAAAAEMTKWFN
TNYHYMVPEFVKGQQFKLTWTQLLEEVDEALALGHKVKPVLLGPVTYLWLGKVKGEQFDR
LSLLNDILPVYQQVLAELAKRGIEWVQIDEPALVLELPQAWLDAYKPAYDALQGQVKLLL
TTYFEGVTPNLDTITALPVQGLHVDLVHGKDDVAELHKRLPSDWLLSAGLINGRNVWRAD
LTEKYAQIKDIVGKRDLWVASSCSLLHSPIDLSVETRLDAEVKSWFAFALQKCHELALLR
DALNSGDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRAR
FKLPAWPTTTIGSFPQTTEIRTLRLDFKKGNIDANNYRTGIAEHIKQAIVEQERLGLDVL
VHGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYA
QSLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDE
PALREGLPLRRSDWDAYLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
VITIETSRSDMELLESFEEFDYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPAERL
WVNPDCGLKTRGWPETRAALANMVQAAQNLRRG
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgacaattcttaatcacaccctcggtttccctcgcgttggcctgcgtcgcgagctgaaa
aaagcgcaagagagttattgggcggggaactccacgcgtgaagaactgctggcggtaggg
cgtgaattgcgtgctcgtcactgggatcaacaaaagcaagcgggtatcgacctgctgccg
gtgggcgattttgcctggtacgatcatgtactgacaaccagtctgctgctgggtaatgtt
ccgcaacgtcatcagaacaacgatggttcggtagatatcgataccctgttccgtattggt
cgtggacgtgcaccgactggcgaacctgcggcggcagcggaaatgaccaaatggtttaac
accaactatcactacatggtgccggagttcgttaaaggccaacagttcaaactgacctgg
acgcagctgctggaggaagtggacgaggcgctggcgctgggccacaaggtgaaacctgtg
ctgctggggccggttacctacctgtggctgggtaaagtgaaaggtgaacagtttgatcgc
ctgagcctgctgaacgacattctgccggtttatcagcaagtgctggcagaactagcgaaa
cgcggcattgagtgggtacagatcgacgaacccgcgctagtgctggaactgccgcaggcg
tggctggatgcatacaaacccgcttacgacgcgctccagggccaggtgaaactgctgctg
accacctattttgaaggcgtaacgccaaacctcgacacgattactgcgctgcctgttcag
ggtctgcatgtcgatcttgtacatggtaaagatgacgttgctgaactgcacaagcgcctg
ccttctgactggctgctgtctgcgggtcttatcaatggtcgtaacgtctggcgcgccgat
cttaccgagaaatatgcgcaaattaaggacattgtcggcaaacgtgatttgtgggtggca
tcttcctgctcactgctgcacagccccatcgacctgagcgtggaaacgcgtcttgatgca
gaagtgaaaagctggtttgccttcgccctgcaaaaatgtcatgaactggcattgctgcgc
gatgcgctgaacagtggtgatacggcagctctggcagagtggagcgctccgattcaggcg
cgtcgtcactctactcgtgtacataatccggcagtagaaaagcgtctggcggcgatcacc
gcccaggacagtcagcgtgcgaatgtctatgaagtgcgtgctgaagcccagcgtgcgcgt
tttaaactgcccgcgtggccgaccaccacgattggttccttcccgcaaaccacggagatt
cgtaccctgcgtctggattttaaaaagggtaatatcgacgccaataactaccgcacgggc
attgcggaacatatcaagcaggccattgttgagcaggaacgtttgggactggatgtgctg
gtacatggcgaggccgagcgtaatgacatggtggaatactttggcgagcatctggatggc
tttgtctttacgcaaaacggttgggtacagagctacggttcccgctgcgtgaagccaccg
attgttattggtgacgttagccgcccggcaccgattaccgtggagtgggcaaaatatgcg
caatccctgactgataaaccggtgaaagggatgttgactggcccggtgactattctctgc
tggtcgttcccgcgtgaagatgtcagccgtgaaaccatcgccaaacagattgcgctggca
ctgcgtgatgaagtggccgatctggaagccgctggaattggcatcattcagattgacgaa
ccggcattgcgcgaaggtttaccactgcgtcgcagcgactgggatgcctatctccagtgg
ggcgtggaggctttccgtatcaacgccgccgtggcgaaagatgacacacaaatccacact
cacatgtgttactgcgagttcaacgacattatggattcgattgcggcgttggacgcagac
gtcatcaccatcgaaacctcgcgttccgacatggagttgctggagtcgtttgaagagttt
gattatccaaatgaaatcggtcctggcgtctatgacattcactcgccaaacgtaccgagc
gtggaatggattgaagccttgctgaagaaagcggcaaaacgcattccggcagagcgtctg
tgggtcaacccggactgtggcctgaaaacgcgcggctggccagaaacccgcgcggcactg
gcgaacatggtgcaggcggcgcagaatttgcgtcgggggtaa

DBGET integrated database retrieval system