KEGG   Escherichia coli NA114 (UPEC): ECNA114_4168
Entry
ECNA114_4168      CDS       T01998                                 

Gene name
metH
Definition
(GenBank) 5-methyltetrahydrofolate--homocysteine methyltransferase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00270  Cysteine and methionine metabolism
ena00450  Selenocompound metabolism
ena00670  One carbon pool by folate
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01230  Biosynthesis of amino acids
Module
ena_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECNA114_4168 (metH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_4168 (metH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ECNA114_4168 (metH)
Enzymes [BR:ena01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     ECNA114_4168 (metH)
SSDB
Motif
Pfam: Met_synt_B12 S-methyl_trans Pterin_bind B12-binding_2 B12-binding
Other DBs
NCBI-ProteinID: AEG39012
Structure
PDB: 

Position
4300247..4303930
AA seq 1227 aa
MSSKVEQLCAQLNERILVLDGGMGTMIQSYRLNEADFRGERFADWPCDLKGNNDLLVLSK
PEVISAIHNAYFEAGADIIETNTFNSTTIAMADYQMESLSAEINFAAAKLARACADEWTA
RTPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDQLVAAYRESTKALVEGGADLILI
ETVFDTLNAKAAVFAVKTEFEALGVELPIMISGTITDASGRTLSGQTTEAFYNSLRHAEA
LTFGLNCALGPDELRQYVQELSRIAECYVTAHPNAGLPNAFGEYDLDADTMAKQIREWAE
AGFLNIVGGCCGTTPQHIAAMSRAVEGLAPRKLPEIPVACRLSGLEPLNIGEDSLFVNVG
ERTNVTGSAKFKRLIKEEKYSEALDVARQQVENGAQIIDINMDEGMLDAEAAMVRFLNLI
AGEPDIARVPIMIDSSKWDVIEKGLKCIQGKGIVNSISMKEGVDAFIHHAKLLRRYGAAV
VVMAFDEQGQADTRARKIEICRRAYKILTEEVGFPAEDIIFDPNIFAVATGIEEHNNYAQ
DFIGACEDIKRELPHALISGGVSNVSFSFRGNDPVREAIHAVFLYYAIRNGMDMGIVNAG
QLAIYDDLPTELRDAVEDVILNRRDDGTERLLELAEKYRGSKTDDTANTQQAEWRSWEVN
KRLEYSLVKGITEFIEQDTEEARQQATRPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVK
SARVMKQAVAYLEPFIEASKEQGKTNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDL
GVMVPAEKILRTAKEVNADLIGLSGLITPSLDEMVNVAKEMERQGFTIPLLIGGATTSKA
HTAVKIEQNYSGPTVYVQNASRTVGVVAALLSDTQRDDFVARTRKEYETVRIQHGRKKPR
TPPVTLEAARDNDFAFDWQAYTPPVAHRLGVQEVEASIETLRNYIDWTPFFMTWSLAGKY
PRILEDEVVGVEAQRLFKDANDMLDKLSAEKMLNPRGVVGLFPANRVGDDIEIYRDETRT
HVINVSHHLRQQTEKTGFANYCLADFVAPKVSGKADYIGAFAVTGGLEEDALADAFEAQH
DDYNKIMVKALADRLAEAFAEYLHERVRKVYWGYAPNENLSNEELIRENYQGIRPAPGYP
ACPEHTEKATIWELLEVEKHTGMKLTESFAMWPGASVSGWYFSHPDSKYYAVAQIQRDQV
EDYAHRKGMSVTEVERWLAPNLGYDAE
NT seq 3684 nt   +upstreamnt  +downstreamnt
gtgagcagcaaagtggaacaactgtgtgcgcagttaaatgaacgtattctggtgctggac
ggcggtatgggcaccatgatccagagctatcgactgaacgaagccgattttcgtggtgaa
cgctttgccgactggccatgcgatctcaaaggcaacaacgacctgctggtgctcagcaaa
ccggaagtgatctccgccatccacaacgcttactttgaagcgggtgcggatatcatcgaa
accaacaccttcaactccacgactattgcgatggcggattaccagatggaatccctgtcg
gcggaaatcaactttgcggcggcgaaactggcgcgcgcctgtgccgacgagtggactgcc
cgcacgccggagaaaccgcgctacgttgccggtgttctcggcccgaccaaccgcacggcg
tctatttctccggacgtcaacgatccggcattccgcaacatcacttttgaccagctggtg
gcggcttatcgagaatccaccaaagcgctggtggaaggtggcgcggacctgatcctgatt
gaaaccgttttcgacacccttaacgccaaagcggcggtctttgcggtgaaaacggagttt
gaagcgctgggcgttgaactgccgattatgatctccggcaccatcaccgacgcctccggg
cgcacgctctccgggcagaccactgaagcgttttacaactccctgcgccacgccgaagcg
ctgacctttggcctgaactgtgcgctggggccagacgaactgcgccagtacgtacaggaa
ctgtcgcgtattgcggaatgctatgtcaccgcccacccgaacgccgggctgcccaacgcc
tttggtgaatacgatctcgacgccgacacgatggcaaaacagatacgtgaatgggcagaa
gcgggctttctcaatatcgtcggcggctgctgcggcaccacgccacaacatattgcagcg
atgagtcgtgcagtagaaggattagcgccgcgcaaactaccggaaattcccgtagcctgc
cgtttgtccggcctggagccgctgaacattggcgaagatagcctgtttgtgaacgtgggt
gaacgcaccaacgtcaccggttccgctaagttcaagcgcctgatcaaagaagagaaatac
agcgaggcgctggatgtggcgcgtcagcaggtggaaaacggtgcgcagattatcgatatc
aacatggatgaagggatgctcgatgccgaagcggcgatggtgcgttttctcaatctgatt
gccggtgaaccggatatcgctcgtgtgccgataatgatcgactcctcgaaatgggacgtt
attgaaaaaggtctgaagtgtatccagggcaaaggcattgttaactctatctcgatgaaa
gagggcgtcgacgcctttatccatcacgcgaaactgttgcgtcgctacggtgcggcagta
gtggtaatggcttttgacgaacagggccaggccgatacccgcgcacggaaaatcgagatt
tgccgtcgggcgtacaaaatcctcaccgaagaggttggcttcccggctgaagatatcatc
ttcgacccgaacatcttcgcggtcgcaactggcattgaagagcacaacaattacgcacag
gactttatcggcgcgtgtgaagacatcaaacgtgaactgccgcacgcactgatttccggc
ggcgtttctaacgtgtcgttctcgtttcgtggtaacgatcctgtgcgcgaagccattcac
gcggtgttcctctactacgctattcgcaatggcatggatatggggatcgtcaacgccggg
caactggcgatttacgacgacctgcctaccgagctacgcgacgcggtggaggatgtgatc
ctcaaccgccgcgacgatggcaccgagcgtttactcgagcttgccgagaaatatcgcggc
agcaaaaccgacgacaccgctaacacccagcaggcggagtggcgctcgtgggaagtgaat
aaacgtctggaatactcgctggtcaaaggcattaccgagtttatcgagcaggataccgaa
gaagcccgccagcaggctacgcgcccgattgaagtgattgaaggcccgttgatggacggc
atgaacgtggtcggcgacctgtttggcgagggcaaaatgttcctgccgcaggtggtgaaa
tcggcgcgcgtaatgaagcaggcggtggcgtatctcgagccgtttattgaagccagcaaa
gagcagggtaaaaccaacggcaagatggtgatcgccacagtgaagggcgatgtccacgac
atcggtaaaaatatcgttggcgtggtgctgcaatgtaacaactacgaaattgtcgatctc
ggcgtgatggtgcctgcggaaaaaattctccgtaccgctaaagaagtgaatgctgatttg
attggcctttcggggctgatcacgccgtcgctggacgagatggttaacgtggcgaaagag
atggagcgccagggcttcaccattccgctattgattggcggcgcgaccacctcaaaagcg
cacacggcggtgaaaatcgagcagaactacagcggcccgacggtgtatgtgcagaacgca
tcgcgcaccgttggtgtggtggcggcgctgctttccgacactcagcgcgatgatttcgtt
gctcgtacccgcaaggagtacgaaaccgtgcgtattcagcacggacgaaagaaaccacgc
acaccaccggtcacgctggaagcggcgcgtgataacgacttcgcttttgactggcaggct
tacacgccgccggtggcgcaccgtctcggtgtgcaggaagtcgaagccagcatcgaaacg
ctgcgtaattacatcgactggacgccgttctttatgacctggtcgctggccgggaagtat
ccgcgcattctggaagatgaagtggtaggtgttgaggcgcagcggctgtttaaagacgcc
aacgacatgctggataaattaagcgccgaaaaaatgctgaacccgcgtggtgtggtgggc
ctgttcccggcaaaccgtgtgggcgatgacattgaaatctaccgtgacgaaacgcgtacc
catgtgattaatgtcagccaccatctgcgccaacagaccgaaaaaaccggcttcgctaac
tactgtctcgctgacttcgttgcgccgaaggtttccggcaaagcggattacatcggcgca
tttgccgtgactggcgggctggaagaggacgcactggctgatgcctttgaagcacagcat
gatgattacaacaaaatcatggtgaaagcgcttgccgaccgtctggcggaagcctttgcg
gagtatctccatgagcgtgtgcgtaaagtctactggggctatgcgccgaacgagaacctc
agcaacgaagagctgatccgcgaaaactaccagggcatccgtccggcaccgggctaccct
gcctgcccggaacatacggaaaaagccacaatctgggagctgctggaagtggaaaaacat
accggtatgaaactcacggaatctttcgccatgtggccgggtgcatcggtttcgggttgg
tacttcagtcatccagacagcaagtattacgcggtggcgcaaattcagcgcgatcaggtt
gaagactatgcccaccgtaaaggaatgagcgttaccgaagttgagcgttggttggcaccg
aatctggggtatgatgccgagtaa

DBGET integrated database retrieval system