KEGG   Escherichia coli NA114 (UPEC): ECNA114_4174Help
Entry
ECNA114_4174      CDS       T01998                                 

Definition
(GenBank) Putative sorbose-specific IIB component of PTS system
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00051  Fructose and mannose metabolism
ena01100  Metabolic pathways
ena02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECNA114_4174
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECNA114_4174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_4174
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     ECNA114_4174
Transporters [BR:ena02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    ECNA114_4174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AEG39018
Position
complement(4310125..4310619)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIGTLNIGGMAWRPGKKQLTKAV
SLDDDDINAFHELNNLGVILDLRVVASDPSINIIDKINEQLIAN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcccgcattgatgaccgcctgatccacggccaggtcactaccgtc
tggtctaaagtggctaacgcccagcgcattattatctgcaatgacgaagtttataacgat
gaagttcgccggacattattgcgtcaggctgcgccaccgggaatgaaggttaacgtggtc
aatattgaaaaagccgtcgcggtgtatcacaacccgcaatatcaggacgaaaccgttttt
tatcttttcactcgcccacaggatgccttagcaatggttcgccagggggtaaaaataggt
accctgaatattggcggcatggcctggcgtcctggtaaaaaacagttaaccaaagcagtt
tcattagatgacgatgatattaacgcatttcatgagttaaataatcttggcgtcatactg
gatttacgcgtcgtagcgtcagatccctcaatcaatattatcgacaaaataaatgaacag
ttaatcgcgaattaa

DBGET integrated database retrieval system