KEGG   Escherichia coli NA114 (UPEC): ECNA114_4218Help
Entry
ECNA114_4218      CDS       T01998                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoamide succinyltransferase component-E2 of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00020  Citrate cycle (TCA cycle)
ena00310  Lysine degradation
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01130  Biosynthesis of antibiotics
ena01200  Carbon metabolism
Module
ena_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ena_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECNA114_4218 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ECNA114_4218 (sucB)
Enzymes [BR:ena01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ECNA114_4218 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H DUF4331
Motif
Other DBs
NCBI-ProteinID: AEG39062
Position
4357212..4358366
Genome map
AA seq 384 aa AA seqDB search
MIEITVPVLPESVTEGTLTTWCKQEGEHVKRDDVIAELETDKVILEIPAPHDGVLSNIIV
SEGSTVTSAQLLAHLKPQAVIEETVTPVTETLAMPSARLEAQRSGVELADVAGSGRNGRI
LKEDVQRVTPAPAIQPERVAEIAPAKPLTPGARQERREPMSRLRQRIAERLLASQQNNAI
LTTFNEVNMQSVMDLRARWKDRFAEKHGVKLGFMSFFVKAVTRALERFPVVNASVDGNEI
IWRDYCDIGIAVSSNRGLVVPVLRNAQSLSLVEIERQIAEYATQARNGKLPLEALQGGTF
SITNGGTFGSMMSTPIINPPQSAILGMHAITPRPVAENGQVVIRPMMYLALSYDHRIIDG
QEAVHTLVAIRELLESPEQLLLDL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattactgtccctgtattaccggaatctgtcacggaaggcacgctgacaacc
tggtgtaaacaagaaggcgagcacgtaaaacgcgatgatgtgattgccgagctggaaacc
gataaagtcattctggaaataccggccccgcacgatggcgtgttaagcaatattatcgtc
agcgaaggtagcacggtcacgtccgcgcaactgttggcgcatcttaagccgcaagctgtc
atagaagaaaccgtcacaccagtcaccgaaaccctggcgatgccttccgcacggctggag
gcacagcgtagtggtgtcgaacttgctgacgttgcggggagcgggagaaatggacgtatc
ctgaaagaggatgtgcagcgcgttactcctgcaccagccattcagcctgaacgggtggcg
gagatcgcgccagctaaacccttgacaccgggtgctcgtcaggaacgtcgtgagccgatg
tcgcgcttacgtcagcgaattgctgagcgtctgctggcttcccaacaaaataacgccatt
cttaccacattcaacgaagtaaacatgcagagcgtgatggacttacgcgcccgctggaaa
gatcgttttgccgagaagcacggcgtgaagctgggctttatgtccttctttgttaaggcc
gttacccgggcgctggagcgcttccctgtagtgaatgccagcgtcgatggcaacgagatt
atctggcgtgattattgcgatatcggcattgcagtgagcagcaaccgcggcctggtagtg
cctgtgttacgcaatgcgcaatcactctctttggtggaaattgaacggcaaattgccgaa
tacgccacacaggcacgcaatggcaaattgccgctggaggcgttacagggcggcacgttc
tctatcaccaacggcggtacttttggttcgatgatgtcaacgccaatcattaacccgccg
cagtcggccattcttgggatgcatgccatcacgccgcgcccggtcgcagaaaacggtcag
gttgttattcgtcccatgatgtaccttgctctcagctatgaccatcgcattatcgatggt
caggaagccgtgcatacattggtggcaatacgtgagctactggaatcaccggaacaactg
ttgctggatctttaa

DBGET integrated database retrieval system