KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00430Help
Entry
ECL_00430         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2859
Motif
Other DBs
NCBI-GeneID: 9122939
NCBI-ProteinID: YP_003610945
UniProt: A0A0H3CFT9
Position
444866..445396
Genome map
AA seq 176 aa AA seqDB search
MKNTLRYTLVFTLFSGLLTSAFSASATLTVVGDLGGESTGPLFDAINAGPGQSATESPVL
PPPPASLSLSDMLPVSTPEMSPGAVAARPLNLPGMPPVFVLGDDASSRHWLTHHATTLSR
MQATGMVISVRDEQGLNALRQLAPGVAMVPVSGGDLARRLALTHYPALITATGISQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacgcttcgttatacccttgttttcacgcttttttcagggctgctgaccagt
gcctttagtgcctctgccacgctgaccgtggtgggcgacctcggcggtgaatccacagga
ccgctgtttgacgccatcaatgccggtccgggtcagtctgcaacggagtcgcccgttctc
ccgccaccgccggcatcgctttccctgtccgacatgctgccggtcagcacgcctgaaatg
tcaccaggcgctgtcgccgcccggccgctgaatcttcccggcatgccgccggtgtttgta
ctgggtgacgatgcgtcttcccgtcattggctcacgcaccacgccaccacgctcagccgc
atgcaggcaaccggcatggttatcagtgtcagggatgagcagggattaaacgcactgcgt
cagctggcgccgggggtggcaatggtgcctgtcagcggcggtgacctggcccgtcgcctg
gcactgacgcattatcctgccctcatcaccgcaacggggatatcacagtga

DBGET integrated database retrieval system