KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00436
Entry
ECL_00436         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 9122945
NCBI-ProteinID: YP_003610951
UniProt: A0A0H3CHI6
Position
450271..450588
AA seq 105 aa
MPHTRILTALLMAVLPALQCHASEKDELALVMRQLDQVQAGLDRARVVANQTQDARFYFD
YQQATRDITTMKQGISTYLEPSRAQPASPSSSVTGQYRAQAPAWR
NT seq 318 nt   +upstreamnt  +downstreamnt
atgcctcatacccgaatcctcacagccctgctgatggccgtcctgcccgcgctgcagtgc
cacgcttcagagaaagatgaactcgcgctggtcatgcgccagctcgaccaggtgcaggcc
gggctggaccgcgcccgcgtggtggcgaaccagacccaggatgcccgcttttacttcgat
tatcagcaggcgacgcgcgatatcaccaccatgaagcaggggatctcaacctatcttgaa
ccctcccgcgcgcagcctgcgtcaccgtcgtcttctgtcaccggacagtaccgcgcacag
gcaccggcatggcgatga

DBGET integrated database retrieval system