KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00448
Entry
ECL_00448         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB
Motif
Pfam: DUF1525 RPN13_C
Other DBs
NCBI-GeneID: 9122957
NCBI-ProteinID: YP_003610963
UniProt: A0A0H3CEI8
Position
461448..461855
AA seq 135 aa
MKLPVCCLAALFLTAGVRAGTVIYTDSTHPVTGNPGPEVTVVLLDAPDRLQAQLFGPLPA
DPAQAEQQARTVIGSPDFQRRQQDLAGAYAGLTRAWSLGLEKYPAVVFDDKWVVYGTSDV
DVATQKLNVWKEKAQ
NT seq 408 nt   +upstreamnt  +downstreamnt
atgaaattacctgtctgctgcctcgcagcacttttccttaccgccggcgtccgtgccggc
accgtcatttataccgacagtacccacccggtcacgggcaaccccggtcctgaagtgacc
gtcgttctgctcgatgcccctgaccggctgcaggcgcagctgttcgggccgctcccggca
gacccggcgcaggctgagcagcaggcgcggacggttatcggttcaccggattttcagcga
cgccagcaggaccttgccggggcttatgccggcctcacgcgtgcctggtcgctgggtctt
gagaaataccccgcggtggtgtttgacgataagtgggtggtttacggcacctctgacgtc
gacgttgccacacagaagctgaacgtatggaaggagaaggcacagtga

DBGET integrated database retrieval system