KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00452
Entry
ECL_00452         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-GeneID: 9122961
NCBI-ProteinID: YP_003610967
UniProt: A0A0H3CDW8
Position
464613..466157
AA seq 514 aa
MTANSFLEYFLILFGWVMNNAMWTILGSTGLFALPLVFKVMGVWLKVREEGADEGNKGLL
ALPRIEHALYVSFVVMLFCCIPLLPVDISTIKFDSSRAKQCGVSVPTPQNSGYSGLVNDF
DGRTAEVPIWWYLLHMISKGTTQAMIASIPCGTELRQMRFDVQNTKLRDPVLLQEVQDFA
NQCYSRAYFRLKNSNSQLSDATINSVGWIGSDYFLNTSGYYDYYTATTPRGQWPYDSTRD
SGYPDTGQGGYPTCKTWWSDGSSGLRKRVLASFGDNTRKEMQRSFPGTQWEEVALRWLVS
PRNAGLSGDGTTYAVGSSDNVTGVVGNMTRLTSTIGLGLKQAEALPGFDALKQALPMIQA
LLQMMIITVIPVLMMFSAYEPKTVVTISFALFALQFITFWWELAGWLDDRLITILYDNMA
QQGLASSVPFANFISSTNDGWIMNLVLGMMYVVFPVFWIGMLSWIGVNLGTAISTGLEKG
GSLPQKAGAEAGRDAQKIATDKAGGALKGGLKLK
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgactgcgaacagttttctggagtattttctcatcctgttcggctgggtgatgaacaac
gccatgtggaccatcctcggcagcacggggctgttcgccctgccgctggtctttaaggtg
atgggtgtgtggctgaaggtccgggaggaaggggcagacgaaggcaacaaagggttgctg
gcactgccccgtatcgagcatgcgctttacgtgtcgtttgtggtgatgttgttctgctgc
attccgctgctgccggtggatatcagtaccattaaattcgacagttcccgggcaaaacag
tgcggtgtcagtgttcccacgccgcagaactccggttacagcggactggtgaacgacttt
gacggccgcacggctgaggtgcccatctggtggtatctgctgcacatgatttcgaaaggc
accacgcaggcgatgattgcgtccatcccgtgcggtacggagctgcgccagatgcggttt
gacgtgcagaacacgaagctgcgtgacccggtattgctgcaggaggtgcaggattttgcg
aaccagtgttactcgcgggcgtactttcgtctcaagaacagcaacagccagctcagcgat
gctaccattaactcggtgggctggattggcagcgactattttctgaatacgtccggctat
tacgattattacaccgccaccacaccgaggggccagtggccttatgacagcacgcgcgac
agcggttatccggataccgggcagggaggctatcccacctgtaaaacgtggtggtcagat
ggctcgtccgggctgcgcaagcgggtactggccagctttggtgacaacacgcgtaaggag
atgcagcgatcattcccggggacgcagtgggaagaggtcgccctgcgctggctggtcagt
ccgcgtaatgccggcctctccggagacggaacgacgtatgccgtgggaagttctgataac
gtgaccggcgtggtcggtaatatgacacgactgacgtccactatcgggctgggcctcaag
caggcggaagcgctgccgggatttgatgcgctgaaacaggcgcttccgatgattcaggcg
ctgctgcagatgatgattattacggtaataccggtcctgatgatgttcagtgcctatgag
cccaaaacggtggtgacgatatcatttgcgctgtttgcgttgcagttcatcacgttctgg
tgggaactggccgggtggctcgatgaccgtctgatcaccatcctctacgataatatggcc
cagcagggactggccagttctgtaccttttgcgaattttatcagctcaaccaacgacggc
tggatcatgaatctggtgctgggaatgatgtatgtggttttcccggtgttctggattggc
atgcttagttggattggcgttaatttgggaactgcaatatcgacaggtttggaaaaaggt
ggttctttgccacagaaggctggtgcagaggcgggtagagatgcccagaagattgctaca
gataaagccggaggtgctttaaaagggggacttaagcttaaatag

DBGET integrated database retrieval system