KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00551
Entry
ECL_00551         CDS       T01231                                 
Symbol
sugE
Name
(GenBank) suppresser of groEL
  KO
K11741  quaternary ammonium compound-resistance protein SugE
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enc02000]
    ECL_00551 (sugE)
Transporters [BR:enc02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ECL_00551 (sugE)
SSDB
Motif
Pfam: Multi_Drug_Res EamA
Other DBs
NCBI-ProteinID: ADF60117
UniProt: A0A0H3CHU6
Position
541197..541514
AA seq 105 aa
MSWIILVIAGLLEVVWAIGLKYTHGFTRLTPSVITVTAMIVSIVLLSWAMRSLPVGTAYA
VWTGIGAVGAAITGILLLGESASLARIASLALIVCGIIGLKLSAH
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtcctggattattcttgttatcgccggtctgctcgaagtggtttgggcaattggtctg
aagtacacccacggatttacccgcctgacacccagcgtgattaccgttaccgccatgatt
gtgagtattgtgctgctctcctgggcgatgcgctctttgccggtggggacggcctatgct
gtctggacgggcattggtgcagtgggcgcggcgattaccgggattttgctgctgggagag
tcggcgagtctggcgcgtatcgccagcctcgcgttgattgtgtgcggtattattgggctg
aaactcagcgcccactaa

DBGET integrated database retrieval system