KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01482Help
Entry
ECL_01482         CDS       T01231                                 

Definition
(RefSeq) 23S rRNA (guanine(745)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:enc03009]
    ECL_01482
Enzymes [BR:enc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ECL_01482
Ribosome biogenesis [BR:enc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ECL_01482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_11 Methyltransf_25 Methyltransf_23 Ubie_methyltran Methyltransf_12 MTS Methyltransf_32 MetW PCMT Methyltransf_29 Methyltransf_9 NodS CMAS Pox_MCEL PrmA
Motif
Other DBs
NCBI-GeneID: 9123985
NCBI-ProteinID: YP_003611991
UniProt: A0A0H3CIS7
Position
1499853..1500668
Genome map
AA seq 271 aa AA seqDB search
MPFSCPLCHARLTRSEKSYACPQGHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYKPLRESVAQLLDHTLTQSASALLDIGCGEGYYTARFAEIAAGKGAQTTGLDVS
KAAIRAAAKRYAGVMFCVASSHRLPFEDASMDAVVRIYAPCKAEELARVVKPGGWVITVT
PGPRHLMELKGLIYDEVRLHAPHSEQLAGFVLRQEETVAYEMDLKGDEAVALLQMTPFAW
RAKPAVRETLAAQATFRCQTDFSIHCWQREG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcagttgccccctttgtcacgcgcgcctgacgcgttctgagaaaagttatgcg
tgtccgcagggacatcagtttgatatggcgaaagaggggtatgtgaatcttctgccggtg
cagcataaacgctcccgcgatccgggcgacagcgcagagatgatgcaggcgcgacgtgcc
tttctggatgccggacattacaagccgctaagagagagtgtcgctcagctgctggaccac
acgctgacgcagagtgcctccgctctgctggatatcggctgtggtgaagggtattacacc
gcaaggtttgccgagattgccgccgggaagggcgcgcagacgacgggtctggacgtgtcg
aaagcggcgattcgcgcagcggcaaaacgctacgcgggggtgatgttctgcgtggcctca
agccaccggctgccgtttgaagatgccagcatggatgccgttgtgcgtatttatgctccc
tgtaaggcagaagagctggctcgggtggtaaaacccggcgggtgggtgataaccgtcacg
ccaggaccacgtcatctgatggagctgaaagggctgatttatgacgaggttcgcctgcat
gctccccattcagaacaactggctggttttgtgctcaggcaggaagaaacagtagcgtat
gagatggatttgaaaggggatgaagccgtggcgttactgcaaatgaccccgtttgcctgg
cgggcaaaaccggctgtccgggagacgctggctgcacaggccacgtttcgctgccagacg
gatttcagcatccactgctggcagcgcgaaggttaa

DBGET integrated database retrieval system