KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01541
Entry
ECL_01541         CDS       T01231                                 

Gene name
hcp
Definition
(RefSeq) type VI secretion system secreted protein Hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:enc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECL_01541 (hcp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enc02044]
    ECL_01541 (hcp)
Secretion system [BR:enc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECL_01541 (hcp)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 9124043
NCBI-ProteinID: YP_003612049
UniProt: A0A0H3CHH7
Position
1562931..1563413
AA seq 160 aa
MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNA
LIDKSTTAILKHCASGKHLTKVELSVCKAGGQQVEYSRITLEDVLVTSVQYTGADNGDTV
GVTYAFQAAKVKQQYWEQTTSGGKGAESSAGWNIKENKEA
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctattgatatgtttctgaaggtcgagggtgttacgggcgaatctaaagattctaac
cacaccggctggactgatattacctccttctcctggggcgcttcccagccaggtaatatg
agcgttggcggtggcggcggtgccggtaaagttaactttaacgatctgcacgttaacgct
ctgatcgacaaatccaccacagcaattctgaaacactgcgccagcggtaaacacctgacc
aaagttgagctgtccgtctgtaaagccggtggccagcaggtggaatactctcgcattacc
ctggaagacgttctggtaacgtctgttcagtacaccggtgcagacaacggcgataccgtt
ggtgtgacctatgcattccaggctgcgaaagtgaaacagcagtactgggagcagaccacc
tctggtggtaaaggtgctgaaagcagcgctggctggaacatcaaagaaaacaaagaagca
taa

DBGET integrated database retrieval system