KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01548
Entry
ECL_01548         CDS       T01231                                 

Gene name
impF
Definition
(RefSeq) type VI secretion system protein ImpF
  KO
K11897  type VI secretion system protein ImpF
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enc02044]
    ECL_01548 (impF)
Secretion system [BR:enc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECL_01548 (impF)
SSDB
Motif
Pfam: GPW_gp25 DUF2113
Other DBs
NCBI-GeneID: 9124050
NCBI-ProteinID: YP_003612056
UniProt: A0A0H3CIY4
Position
1568782..1569345
AA seq 187 aa
MSNPAGEGDLLRSGWQARSKQEKVGARDKMQPSLLDRLTDNDPEKKRESANSNLITHAAL
RRNVLRDLQWLFNTINHDASGDLSMLPHVSRSVVNFGVAPLAGKRMSDIEWHDIQRKLTE
AIVNFEPRILPQGLQVRCVSDTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGH
FELKDAG
NT seq 564 nt   +upstreamnt  +downstreamnt
atgagtaatcctgctggcgaaggcgatctgctgcgcagcggctggcaagcccgcagtaag
caggagaaggtgggggcgcgcgataaaatgcagccctcgctgctcgatcgcctcaccgat
aacgacccggagaaaaagcgcgagtcggccaacagcaacctgatcacccatgccgcgctg
cgtcgcaacgtgctgcgggatctgcagtggctgtttaataccatcaatcacgacgcctcc
ggcgatttgagcatgctgccacacgtaagccgttcggtagtgaattttggcgttgcgccg
ctggccggaaagcgcatgtcggatatcgaatggcacgacattcagcgcaaactcaccgag
gccattgtcaactttgaaccccgcattttgccccaggggctgcaggtccgctgtgtgtcg
gacacctcctcgctggatctgcacaacgtgctctccatcgagataaaagggcgtttgtgg
tgtgtgccgtacccgctggagtttctgtttcgtaccgatgtcgatctggaaaacggccac
tttgaactgaaagatgcggggtga

DBGET integrated database retrieval system