KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01549
Entry
ECL_01549         CDS       T01231                                 

Gene name
impG
Definition
(RefSeq) type VI secretion system protein ImpG
  KO
K11896  type VI secretion system protein ImpG
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enc02044]
    ECL_01549 (impG)
Secretion system [BR:enc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECL_01549 (impG)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-GeneID: 9124051
NCBI-ProteinID: YP_003612057
UniProt: A0A0H3CKN0
Position
1569342..1571219
AA seq 625 aa
MIVESKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYTERLMEGFAFLTS
RVQMKMDAEFPRFSQRLLEMIAPNYLAPTPSMAIAEIQPDSSRGDLSNGFIVPRGTMMDS
LALKKTGVTCSYTTAHEVNLLPLKIDKVELGGVPADLPLTQLGLGQQGISSALRIRIACD
GPQNLGHLDFDRLEFFLSGPDIEALKLLELVMEHHVGVVCQTVSKHPQRDVLASDALRQE
GFDADQSLLPDDLRNFDGYRLLQEYFAFPARFRFISLSGLSKLIQRCENEKAFDIFILLD
KTDEQLERVVDASHLALHCTPVINLFPKVAARQKLSEGQHEYHLVVDNIRPLDYEIYAVN
KIYGSADGQRDDQTFRPFWSTWSGDAGNYGAYFSLRREQRVLSEHALRYGTRTGYIGSEV
FVSLVDEQHAPWQENLRYISAEVLCTSRDLPLMLQQELGQFIMADSMPVKSLTLRKGPTP
PRPALAEGFSTWRLISQLQMNYLSLMDSENEEGAAALRQLLGLYANLAETPVARQVEGVR
HCVLEPVHRRVPEPGPVVFARGIGITLTVDERAFSGASPWLFGSVLERLFARLVSINSFT
EFTLKSQQRGEIGYWAPRMGKRALV
NT seq 1878 nt   +upstreamnt  +downstreamnt
gtgatcgtggaaagtaaactgctcgaatattacaaccgtgagctggcctatctgcgtgag
atgggcgccgaatttgccgagcgctatcccaaagtggccggacggctgggcatgcgcggc
atcgaagtggcggatccgtacaccgaacgactgatggagggctttgcctttctgacctcg
cgcgtgcagatgaaaatggacgcggagtttccgcgcttctcccagcgcttgctggagatg
attgcgccgaactatctcgcgcccactccgtccatggcgattgctgaaattcagcctgac
agcagccgtggcgatttgagcaacggttttatcgtgccacgcggcacaatgatggacagc
ctggcgctgaagaaaaccggcgtgacctgcagctacaccacggcgcatgaggtgaacctg
ctgccgctgaaaatcgacaaggttgagctgggcggtgtgcctgccgacctgcccctgaca
cagcttggtctgggccagcaggggatcagcagcgccttacggatccgcattgcctgcgac
ggtccgcaaaacctcggccaccttgattttgaccggctggagtttttccttagtggcccg
gatatcgaggcgttaaagctgctggagctggtaatggagcaccatgtcggggtggtctgc
cagaccgtcagcaaacatccgcagcgtgatgtgctggcgtctgatgccctgcgtcaggaa
gggtttgacgcggatcagtcgctactcccggacgatctgcgcaactttgacggctaccgt
ctgttgcaggagtactttgcttttccggcccgtttccgcttcatcagcctgagcgggctg
agcaaactgatccagcgctgcgaaaacgaaaaagccttcgatatcttcattctgctggat
aaaaccgatgaacagctggagcgcgttgtcgatgccagccatctggccctgcactgcacg
ccagtgatcaacctgttcccgaaggtagcggcgcgtcagaagctgagcgaaggccagcat
gaataccatctggtggtggataacatccgcccgctggattatgaaatttacgcggtaaac
aagatatacggcagtgcggatggtcagcgcgacgaccagacgtttcgtccgttctggagc
acctggagcggcgatgcaggcaactacggggcctacttttccctgcgccgggaacaacgc
gtgctctctgagcacgccctgcgttacggcacccgcaccggctacattggctcagaggtc
tttgtctcgctggtggatgagcagcatgcaccctggcaggagaacctgcgctatatctcc
gccgaggtgctgtgcaccagccgggatctgccgctgatgctgcagcaggagctgggacag
ttcattatggctgactccatgccggtgaagtcgctgaccttgcgtaaggggccgacgccg
ccgcgtccggcgctggcagaagggttcagcacctggcggttgatcagccagctacagatg
aactacctcagcctgatggacagtgaaaacgaagagggcgccgccgcgctgcgtcagctg
ttagggctgtacgccaatctcgcggagacgccggttgcgcgtcaggtagaaggggttcgt
cactgcgtgctggagccggttcaccgccgcgtgcccgagccgggaccggtcgtcttcgcc
cgtggcatcggcattaccctgacggtggatgaacgtgcgttttccggtgccagtccctgg
cttttcggtagcgtgctggagcggctgtttgcccgtctggtgtcgatcaacagcttcacg
gaattcaccctgaaaagtcagcagcgcggcgagatcggctactgggcgccgcgtatgggc
aaaagggcactggtatga

DBGET integrated database retrieval system