KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01558Help
Entry
ECL_01558         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:enc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECL_01558
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enc02044]
    ECL_01558
Secretion system [BR:enc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECL_01558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Phage_base_V Nsp3_PL2pro Sarcoglycan_1
Motif
Other DBs
NCBI-GeneID: 9124060
NCBI-ProteinID: YP_003612066
UniProt: A0A0H3CIZ3
Position
1582007..1583935
Genome map
AA seq 642 aa AA seqDB search
MLNRITVQLPVEGLLFWKLSGREAMSESFALTLTLLGTDARIDRSKLLGQPVTVTIPTQN
LLTPRYINGKVTRVAVSAVELTGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTVPQIVKT
LLGEHQVNVEDKLTGSYRVWDYCVQYQESSLDFISRLMELEGIAYYFSHEADKHTLVLTD
AATQHQPFSGYEVIPYHQTPSGGSTDEEGISQWALEDSVTPGIYSLDDYDFRKPNAWLFQ
AQQNPASPKPGSIDVYDWPGRFVETGHAEFYARIRQERWQVEHQQIQATATAAGIAPGHT
FTLTNAPFFSDNGDYLVTAAGYHLEENRYASGEGETIHRIDFTVIPASVSFRPAQSTAWP
RTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGGV
QIPRVGDEVVVDFINGDPDRPIITGRVYNDASMPPWALPAAATQMGFMSRTKDGSVDNAN
ALRFEDKAGAEQVWLQAERNLDINVKNDESHATEKNRTQYVGEDETLRVAKNQKAGVKGD
VVCLTGNSRSDKVVNDFIISAGNTLRLECGESAIELSKDGSVNIIGNNFNFTAKQSAQIN
TLSGELHLNPADGSNAIDAPGASHQTAIQQEVDGFFVFNANK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaccgaattaccgttcagctccccgtcgaggggctgcttttctggaaactctcc
ggccgcgaggcgatgtccgagtcgttcgccctgacgctgaccctgctcggcacggatgcg
cgtatcgaccgcagcaaactgctgggccagccggtcacggtgaccatccccacccagaac
ctgcttaccccgcgctacatcaacggtaaagtcacgcgcgtggcggtgagcgccgttgag
ctgacgggcacacgctatgcggtgtatcagctgacggtggagccggacctgtggccgatg
aagcgcgaccgtaacctgcgtatcttccaggggcagacggtgccgcagattgtgaaaacc
ctgctgggcgagcatcaggtcaacgtggaagataagctcaccggcagctaccgggtgtgg
gactactgtgtccagtatcaggagtcgagcctggacttcatcagccgcctgatggagctg
gaggggatagcgtattacttcagccacgaggccgacaaacacaccctggtgctcaccgat
gccgccacgcagcatcagccgttcagcggctacgaggtcatcccctatcaccagacgccg
tccggcggcagcacggacgaagagggtatcagccagtgggcgctggaggacagcgtgacg
ccgggcatttacagcctcgacgactacgacttccgcaagccgaacgcgtggctgttccag
gcgcagcagaacccggcctcgccgaagccaggcagcattgacgtgtacgactggccgggg
cgctttgtggagaccgggcatgcggagttctacgcccgcattcgtcaggagcgctggcag
gtggagcatcagcagattcaggccacggccacggcggcgggtattgcgccgggccacacc
ttcaccctgaccaacgcaccgttcttcagcgataacggtgactatctggtgacggcggcc
gggtatcatctggaagagaaccgctatgccagcggcgaaggggagaccatccaccgcatc
gatttcacggttatcccggcgtcggtgtcgttccgtccggcgcagtccacggcgtggccg
cgtacctacggcccgcagacggcgaaggttgtcgggccccagggagagagcatctggacg
gacaaatatggccgcgtgaaggtgaaattccactgggaccgtctggcaaaaggggacgac
accagctcctgctgggtgcgcgtgtcgagcgcctgggcgggccagggctacggtggggtg
cagatcccgcgcgtgggcgatgaggtggtggtggactttatcaacggtgacccggaccgt
cctattatcaccgggcgcgtgtacaacgatgccagcatgccaccgtgggcgctgccggcg
gcggcgacgcagatgggctttatgagccgcacgaaagatggctccgtggataacgccaac
gccctgcggtttgaggacaaggcgggtgcggaacaggtgtggctccaggccgagcgcaat
ctcgatatcaacgtcaaaaatgatgaatcgcatgccacggaaaaaaatcgaacccaatat
gtgggagaggatgaaaccttacgggtggcaaaaaatcagaaggcaggggttaaaggggat
gtggtctgcctgacgggcaacagccgcagcgataaagttgttaatgactttattatttca
gcgggcaatacgttgaggctggagtgtggtgaaagcgctatcgaattatcaaaagacggg
agcgtgaatatcattggcaataactttaactttaccgcaaaacagagtgcgcaaataaac
acgctttccggggaattgcatcttaaccctgctgatggcagcaatgccatcgatgcgcca
ggggcatctcaccagacagcaatccagcaggaagtggatggtttttttgttttcaatgct
aataagtaa

DBGET integrated database retrieval system