KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01901Help
Entry
ECL_01901         CDS       T01231                                 

Definition
(RefSeq) formate dehydrogenase
  KO
K08348  formate dehydrogenase-N, alpha subunit [EC:1.17.5.3]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECL_01901
Enzymes [BR:enc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.5  With a quinone or similar compound as acceptor
    1.17.5.3  formate dehydrogenase-N
     ECL_01901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdop_Fe4S4 Molybdopterin TAT_signal DUF1358 CytB6-F_Fe-S
Motif
Other DBs
NCBI-GeneID: 9124398
NCBI-ProteinID: YP_003612404
UniProt: A0A0H3CII8
Position
1933745..1934332
Genome map
AA seq 195 aa AA seqDB search
MDVSRRQFFKICAGGMAGTTAAMLGFAPKMALAQARNYKLLRAKEIRNTCTYCSVGCGLL
MYSLGDGAKNAREAIYHIEGDPDHPVSRGALCPKGAGLLDYVHSDNRLRYPEYRAPGSDK
WQRISWDEAFSRIARLMKADRDANFIEKNAQGVTVNRWLSTGMLCASAASNETGMLTQKF
VRSLGMLAVDNQARV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcagccgcagacaattttttaaaatctgcgcgggcggtatggccggaacaaca
gccgcgatgctgggattcgctcccaaaatggcgctggctcaggcgcgcaactataaactg
ctgcgtgccaaagagatccgtaacacctgcacatactgctccgtgggttgtgggctttta
atgtatagcctgggcgatggcgcgaagaacgccagagaggccatttatcatattgaaggg
gatccagaccatccggtgagccgtggggcactctgcccgaaaggggcgggactgctggac
tacgttcacagcgataaccgtctgcgctatccggaataccgcgcgccgggttccgacaaa
tggcagcgtatttcctgggatgaagccttctcccggattgccagactgatgaaagccgac
cgcgacgccaacttcattgagaagaacgcgcagggcgtgacggtgaaccgttggctctct
accggcatgctgtgcgcctcggcggccagcaatgaaaccggcatgctaacgcaaaaattt
gttcgctccctcgggatgctggcggttgataaccaggcgcgcgtctga

DBGET integrated database retrieval system