KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01906Help
Entry
ECL_01906         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
  KO
K22468  polyphosphate kinase [EC:2.7.4.1]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00190  Oxidative phosphorylation
enc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECL_01906
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ECL_01906
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:enc03019]
    ECL_01906
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.1  polyphosphate kinase
     ECL_01906
Messenger RNA biogenesis [BR:enc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     ECL_01906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPK2 Microtub_bd AAA_30
Motif
Other DBs
NCBI-GeneID: 9124403
NCBI-ProteinID: YP_003612409
UniProt: A0A0H3CIJ5
Position
complement(1938906..1939724)
Genome map
AA seq 272 aa AA seqDB search
MASNKKTSVAVDVVKNAPLKTKEYEKELRRLHVELVKLQQWVVAKGLKVCIVFEGRDGAG
KGGTIKAITERVSPRVFRVVALPAPTEKEKTQLYFQRYVPHLPAAGEIVIFDRSWYNRAG
VERVMGFCTPEQVEKFLDGAPVMEKAMVDAGIILLKYWLEVTPKEQERRLRDRINDGRKI
WKLSPMDIKSFNLWDEYTVARDAMFASTDTAWAPWFVARSEDKKRVRLNIISHLLSQIPY
KELHVEKVDLPKRKIGKVKPTKYPFRYIAEKF
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtaataagaaaaccagcgtcgctgttgatgtcgttaaaaatgcccctctgaaa
acaaaagagtatgaaaaagagcttcgtcgccttcacgttgaactggtcaaactccagcaa
tgggttgtcgccaaaggattaaaagtctgcatcgtgtttgagggacgagacggggccggt
aaaggcggcaccataaaagcgataaccgaacgcgtcagcccgcgcgtattccgggttgtc
gcgctgcctgcgcctacagaaaaagagaaaacgcagctctatttccagcgttatgttccg
cacctgcccgctgccggtgaaatcgttatttttgaccgcagctggtacaaccgcgcaggc
gttgaacgggtgatggggttctgcacgccggaacaggttgaaaagtttcttgatggcgca
ccggtgatggaaaaagcgatggtcgatgccgggatcattttgctgaaatactggcttgaa
gtgacgccgaaagagcaggaacgcaggctacgcgatcgcattaacgatggccgcaagatc
tggaaattatcgcctatggatattaaatcgttcaatttatgggatgaatacaccgtagcg
cgggatgccatgtttgcctccacggacactgcctgggcaccgtggtttgtggcgcgctcg
gaagataaaaaacgcgtgcggttgaatattatctcccatctgctttcgcagatcccgtat
aaagaacttcacgttgaaaaagtggatttgccgaagcgcaaaattggcaaagtcaaaccg
acaaaatatcctttccgatatattgcggagaaattctga

DBGET integrated database retrieval system