KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01907Help
Entry
ECL_01907         CDS       T01231                                 

Definition
(RefSeq) major facilitator transporter AraJ
  KO
K08156  MFS transporter, DHA1 family, arabinose polymer utilization protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
Transporters [BR:enc02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    ECL_01907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 9124404
NCBI-ProteinID: YP_003612410
UniProt: A0A0H3CJH9
Position
1939892..1941067
Genome map
AA seq 391 aa AA seqDB search
MKKTIFSLALSTFGLGMAEFGIMGVLTELAHDTGISIPSAGNMISFYAFGVVIGAPIVAL
FSSKFSLKTTLLFLVALCAVGNAMFTFSTSYFWLAAGRLISGFPHGAIFGVGAIILSKIA
PPGKVTVAVAGMIAGMTVANLVGVPFGTWLGHTFNWRYTFFLIALFDALVILSVLVWVPN
LHDASEIKLTEQFHFLKKPEPWLIFAATMFGNAGVFAWFSFVKPFMVNVSGFSEGLMTII
MMLMGFGMVLGNLLSGKLSGRFSPLRIAATTDMVIVASLLLLFAFGEQKTASLVMGFICC
AGLFALSAPLQILLLQNAKGGEMLGAAGGQMAFNLGSAIGAYFGGMMITLGFSWSYVTLP
AAILSFLAMSALLVYGYLRARRAQSDARALA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacaattttctcgttagcccttagcacgtttggcctgggcatggctgaattt
ggtattatgggtgtcctgacggaactggcgcatgataccggtatttccattccctccgcc
ggaaatatgatttcgttttacgcctttggcgtggtgattggcgcgccgattgtggcgctg
ttttccagtaagttctcgttaaaaaccacgctgctgtttctggttgccctatgtgcggtg
ggtaacgcgatgtttaccttttccacatcctatttttggctggcggcagggcgcttaatc
tcggggttcccgcacggcgcaattttcggcgtgggggcgattatcctctcgaaaatagcg
ccaccgggtaaggtgacggtggccgtggcggggatgatcgccgggatgaccgtggcgaat
ctggtgggggttccgtttggaacctggctggggcatacattcaactggcgttataccttt
ttcctgatagccctgtttgacgcgctggtgatcctctcggtgctggtgtgggtaccaaac
cttcatgacgcatcagaaataaaactcaccgagcagtttcacttcctgaaaaaaccggaa
ccgtggctgattttcgctgccaccatgtttggcaacgctggcgtttttgcgtggttcagt
tttgtgaagccgtttatggtcaatgtctctggcttctccgaggggttgatgacgatcatc
atgatgttgatgggcttcggcatggtgctgggtaacctgctgagcgggaaactatcgggt
cgtttcagcccgctgcgtattgctgccaccaccgatatggtgattgtcgcctcactgtta
ttgcttttcgcctttggtgaacagaaaaccgcgtcgctggtgatggggttcatctgctgt
gccgggctgttcgcactctctgcaccactgcaaattctgctgctgcaaaatgcgaaagga
ggggaaatgcttggtgccgcaggcgggcagatggcctttaacctgggcagtgcgattggt
gcttattttggcggaatgatgattacgctcggttttagctggagctatgtcacgctaccg
gcggcgatattatccttcctggcgatgagcgcgctgctggtgtatggctatctgcgcgcc
cggcgggctcagtctgatgctcgtgcgctggcctga

DBGET integrated database retrieval system