KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01907Help
Entry
ECL_01907         CDS       T01231                                 

Definition
(RefSeq) major facilitator transporter AraJ
  KO
K08156  MFS transporter, DHA1 family, arabinose polymer utilization protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enc02000]
    ECL_01907
Transporters [BR:enc02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    ECL_01907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 9124404
NCBI-ProteinID: YP_003612410
UniProt: A0A0H3CJH9
Position
1939892..1941067
Genome map
AA seq 391 aa AA seqDB search
MKKTIFSLALSTFGLGMAEFGIMGVLTELAHDTGISIPSAGNMISFYAFGVVIGAPIVAL
FSSKFSLKTTLLFLVALCAVGNAMFTFSTSYFWLAAGRLISGFPHGAIFGVGAIILSKIA
PPGKVTVAVAGMIAGMTVANLVGVPFGTWLGHTFNWRYTFFLIALFDALVILSVLVWVPN
LHDASEIKLTEQFHFLKKPEPWLIFAATMFGNAGVFAWFSFVKPFMVNVSGFSEGLMTII
MMLMGFGMVLGNLLSGKLSGRFSPLRIAATTDMVIVASLLLLFAFGEQKTASLVMGFICC
AGLFALSAPLQILLLQNAKGGEMLGAAGGQMAFNLGSAIGAYFGGMMITLGFSWSYVTLP
AAILSFLAMSALLVYGYLRARRAQSDARALA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacaattttctcgttagcccttagcacgtttggcctgggcatggctgaattt
ggtattatgggtgtcctgacggaactggcgcatgataccggtatttccattccctccgcc
ggaaatatgatttcgttttacgcctttggcgtggtgattggcgcgccgattgtggcgctg
ttttccagtaagttctcgttaaaaaccacgctgctgtttctggttgccctatgtgcggtg
ggtaacgcgatgtttaccttttccacatcctatttttggctggcggcagggcgcttaatc
tcggggttcccgcacggcgcaattttcggcgtgggggcgattatcctctcgaaaatagcg
ccaccgggtaaggtgacggtggccgtggcggggatgatcgccgggatgaccgtggcgaat
ctggtgggggttccgtttggaacctggctggggcatacattcaactggcgttataccttt
ttcctgatagccctgtttgacgcgctggtgatcctctcggtgctggtgtgggtaccaaac
cttcatgacgcatcagaaataaaactcaccgagcagtttcacttcctgaaaaaaccggaa
ccgtggctgattttcgctgccaccatgtttggcaacgctggcgtttttgcgtggttcagt
tttgtgaagccgtttatggtcaatgtctctggcttctccgaggggttgatgacgatcatc
atgatgttgatgggcttcggcatggtgctgggtaacctgctgagcgggaaactatcgggt
cgtttcagcccgctgcgtattgctgccaccaccgatatggtgattgtcgcctcactgtta
ttgcttttcgcctttggtgaacagaaaaccgcgtcgctggtgatggggttcatctgctgt
gccgggctgttcgcactctctgcaccactgcaaattctgctgctgcaaaatgcgaaagga
ggggaaatgcttggtgccgcaggcgggcagatggcctttaacctgggcagtgcgattggt
gcttattttggcggaatgatgattacgctcggttttagctggagctatgtcacgctaccg
gcggcgatattatccttcctggcgatgagcgcgctgctggtgtatggctatctgcgcgcc
cggcgggctcagtctgatgctcgtgcgctggcctga

DBGET integrated database retrieval system