KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01911Help
Entry
ECL_01911         CDS       T01231                                 

Definition
(RefSeq) 30S ribosomal subunit S22
  KO
K02972  stationary-phase-induced ribosome-associated protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:enc03009]
    ECL_01911
Ribosome biogenesis [BR:enc03009]
 Prokaryotic Type
  Other maturation factors
   ECL_01911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S22
Motif
Other DBs
NCBI-GeneID: 9124408
NCBI-ProteinID: YP_003612414
UniProt: A0A0H3CIK0
Position
complement(1946247..1946384)
Genome map
AA seq 45 aa AA seqDB search
MKSNRQARHILGLNYKLSNQRKVVIEGDSETQVTHATGRKRHAGK
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgaaccgtcaggcacgccatatactgggactgaactacaagctttctaaccaa
cgtaaagtggtgattgaaggcgacagtgaaacacaggtcactcacgccaccggcagaaaa
cgccacgcgggcaagtaa

DBGET integrated database retrieval system