KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01914Help
Entry
ECL_01914         CDS       T01231                                 

Definition
(RefSeq) LysR family transcriptional regulator
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_28 HTH_IclR HTH_29 HTH_23 HTH_8 NUMOD1 HTH_24 MarR_2 HTH_5 SesA HTH_30 HTH_3 HTH_45
Motif
Other DBs
NCBI-GeneID: 9124411
NCBI-ProteinID: YP_003612417
UniProt: A0A0H3CLL0
Position
1947891..1948784
Genome map
AA seq 297 aa AA seqDB search
MDRVIAAQVYNRICELGSLSAAARALGISRPMVSRYLEQMEKWAGTRLVNRSTRKLTLTA
AGEKVLLKTRTLSQLSQEIEGQSEKDLPSGTLRVACAHFTAMHLIAPVLPGLLSRYPQLR
IELDVNNHPVSLVGERIDVAIRITDNPEPGMIARRLGECRSVLCASPQYLATHGTPEQVE
ELAQHNCLHYSFFAGQAWHFLTPEGENVSVAVSGNLSASISSLLMEAAVKHCGIAMLPEQ
EAHAAIEQGTLVPVLSSLTPKALAIHGIYQSREYQPAALRVFLDEIAHHLSGDAQRE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcgttattgccgctcaggtctataaccggatatgcgagctgggaagcctgagt
gcagcggcccgggcgttggggatctcccgtcctatggtgagccgctatcttgagcaaatg
gagaagtgggccggtacgcggctggtaaaccgctcgacgcgcaagctgacgctgacggcg
gccggagagaaggtgctgctaaaaacgcgaacgctgtcccagctgtcgcaggaaattgaa
ggccagtcggagaaagatctcccttcaggcacgctacgggtggcctgcgcccattttacc
gccatgcatctgattgccccggtgctgcccggcttgctttcgcgctacccgcagctgcgc
attgagctggatgtgaacaaccacccggtgagtctggtaggggaacgcattgatgtggcg
atccgcattacggataacccagagcccgggatgatcgcccgcaggcttggggagtgccgt
tccgtgctgtgcgcgtcgccgcagtatcttgcaacccacggcacgccagagcaggtggag
gagttagcgcagcacaactgtctgcactacagctttttcgccggtcaggcgtggcacttc
ctgacgccggaaggggaaaacgtcagcgtcgccgtgagcggcaacctcagcgccagcatc
tcgtcattgttgatggaggcggcggtgaagcattgcggcattgccatgttgccggagcag
gaagcacatgccgcgattgaacagggcacgctggtcccggtgctgagcagcctgacgccc
aaagcgttagccattcacggtatttatcagtcccgggagtatcagcccgcggcgttgcgc
gtgtttcttgatgagatagcgcaccatctgtcaggcgacgcgcagcgggaatag

DBGET integrated database retrieval system