KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01915Help
Entry
ECL_01915         CDS       T01231                                 

Definition
(RefSeq) OsmC family protein
  KO
K04063  osmotically inducible protein OsmC
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    ECL_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OsmC
Motif
Other DBs
NCBI-GeneID: 9124412
NCBI-ProteinID: YP_003612418
UniProt: A0A0H3CHV1
Position
1948866..1949294
Genome map
AA seq 142 aa AA seqDB search
MTIHKHGSAHWSGDIKNGKGTVSTESGVLNQQPYGFNTRFESAKGTNPEELIGAAHAACF
SMALSLMIGEAGYTADSIDTTADVSLDKTDGGFAISKIALNSKVTVPGIDPQKFDGIIQK
AKAGCPVSQVLKAEITLDYKLN
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcataagcacggttcggcacactggtctggtgatatcaaaaatggcaaaggg
acggtctcaacggaaagtggcgtcctgaatcaacaaccttacggctttaacacccgcttc
gaaagcgctaaaggcactaacccggaagagttgattggcgcagctcacgccgcctgtttt
tcaatggcgctgtcgctgatgattggtgaagcgggctataccgccgattccatcgatacc
acggcggatgtctcgctggataaaaccgatggcggcttcgcaatcagcaaaattgcgcta
aacagcaaggtcaccgtaccgggtatcgacccgcagaaattcgacggcatcatccagaaa
gcgaaagcaggatgcccggtgtcgcaggtactgaaagcggaaatcacgctggactataaa
cttaactaa

DBGET integrated database retrieval system