KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01921Help
Entry
ECL_01921         CDS       T01231                                 

Definition
(RefSeq) peptide/nickel transport system permease protein
  KO
K02033  peptide/nickel transport system permease protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc02024  Quorum sensing
Module
enc_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:enc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECL_01921
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enc02000]
    ECL_01921
Transporters [BR:enc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    ECL_01921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 9124418
NCBI-ProteinID: YP_003612424
UniProt: A0A0H3CIL1
Position
complement(1953902..1954924)
Genome map
AA seq 340 aa AA seqDB search
MTFWSIVRQRCWGLILVVAGVCIITFIISHLIPGDPARLLAGDRASDEIVQNIRQQLGLD
QPLYIQFGRYVDALAHGDLGTSIRTGRPVAEDLKAFFPATLELAFCSLLLALVIGVPLGI
LSAVYRNRWLDHLVRLMAMTGISTPAFWLGLGVIVLFYGHLQLLPGGGRLDDWLDPPAHV
TGFYLLDALLEGNGEVFFNALQHLILPSLTLAFVHLGIVARQVRSAMLEQLSEDYIRTAR
ASGLPGWYIVLRYALPNAMIPSITVLGLALGDLLYGAVLTETVFAWPGMGAWVVTSIQAL
DFPAVMGFAVVVSLAYVVVNLVVDLLYLWIDPRIGRGGAE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgttctggagcattgtgcgccagcgctgctgggggttaatcctggtagtagccggt
gtctgtatcatcacctttatcatttcacacctgatccccggcgatccggcccgcctgctc
gccggtgaccgtgccagcgacgagattgtgcaaaacattcgccagcaactgggactggat
cagccgctctatatccagtttggccgctatgtagacgccctggcgcacggcgatttaggg
acctctatccgtaccgggcggccggtggcggaagatttaaaagccttcttccctgccacg
ctggagctggcgttctgttccctgctgctggcgctggtgatcggcgttccgctggggatt
ttatcggcggtctaccgtaaccgctggctggatcatctggtacggctgatggcgatgaca
gggatctccacacctgccttctggctgggtctgggcgtcatcgtcttgttctacggccat
ctgcagcttctgcccggcggcggcaggctggacgactggctcgacccgcctgcccacgtg
acgggcttttatctgctggatgccctgctggagggtaacggcgaggtctttttcaacgcc
ctgcaacacctgattttaccgtcactgacgctggcgtttgttcatcttggcatcgtggcg
cgtcaggtacgttccgccatgctggagcagctcagcgaagattatattcgcaccgcccgc
gccagcggcttgccgggctggtatatcgtcctgcggtatgccctgccgaatgcgatgatc
ccgtccattaccgtactcgggctggcgctgggcgatctgctttatggtgcggtactgacc
gaaaccgtctttgcctggccaggcatgggcgcctgggtggtgacctccattcaggcgctg
gatttccctgccgtcatgggcttcgccgtggtggtttcactggcctatgtggtcgtcaat
ctggtggttgatctgctctatctgtggattgaccctcgtatcgggcgcggaggtgccgaa
tga

DBGET integrated database retrieval system