KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01924Help
Entry
ECL_01924         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_6 SIS
Motif
Other DBs
NCBI-GeneID: 9124421
NCBI-ProteinID: YP_003612427
UniProt: A0A0H3CLL9
Position
complement(1957083..1957937)
Genome map
AA seq 284 aa AA seqDB search
MTTKPEMLNRIEATFSQLTPSEKRVASWMLAHAALIPFETAESVALTTGTSGITVGRFLR
KLGYRNLDDAKKSLRDPYQPWGMNERLDSWQQQRPLSDRLQHSLSLEVDAITHVYQLAQT
DVFKQIVHQLTHAEAVFVLGIQSTRGIANAFFSHLEYLRPRVSYSEGLSGSWVESLNSGF
DHPYVVLTDTRAYSAIARQYCRVASEKSIPMALITDIWCPWARDYPIDLLQVKTDTGHFW
DSLAPVSCLFNLLLSGVVQALGDALADRLTINRELQQEFGQFER
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaaacctgaaatgctgaaccgtatcgaagccaccttcagccagctgacgccc
agcgaaaagcgtgtggcaagctggatgctggcgcacgccgcgctgataccgtttgagacg
gcagagagcgtggcgctgactaccggcaccagcgggatcaccgtcgggcgcttcctgcgc
aagctggggtatcgcaacctggacgatgcgaaaaaaagcctgcgcgatccttatcagccc
tggggaatgaacgaacgcctggactcctggcaacagcagcgcccgctctcggatcgcctc
cagcactccctttcgctggaggtggacgcaatcacccatgtttatcagctggcacaaacc
gatgtctttaagcaaatcgtccatcagctcacccatgctgaggcggtgtttgtgctgggt
attcagtcaacgcgcgggattgccaacgccttcttcagccacctggaatacctgcgcccg
cgcgtgagctactccgaggggttatccggcagttgggttgaatcgctcaactccggtttt
gaccacccttatgtggtgctgaccgatacccgcgcctattccgccattgcccggcagtac
tgtcgtgtcgcaagtgagaaaagtattccaatggccctgatcaccgatatctggtgtccg
tgggcgcgggattaccctattgatttattgcaggttaaaaccgataccggccacttctgg
gattcgctggcccctgttagctgtcttttcaacctgctgctgtcaggcgtggtccaggcg
ctgggtgatgcgcttgcagaccgtctgacgataaaccgtgaattacaacaagagtttgga
caattcgaacgctaa

DBGET integrated database retrieval system