KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01949Help
Entry
ECL_01949         CDS       T01231                                 

Definition
(RefSeq) Malto-oligosyltrehalose trehalohydrolase
  KO
K01236  maltooligosyltrehalose trehalohydrolase [EC:3.2.1.141]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00500  Starch and sucrose metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
Module
enc_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECL_01949
Enzymes [BR:enc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.141  4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase
     ECL_01949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 CBM_48
Motif
Other DBs
NCBI-GeneID: 9124444
NCBI-ProteinID: YP_003612450
UniProt: A0A0H3CJP2
Position
1982105..1983889
Genome map
AA seq 594 aa AA seqDB search
MEFRTFQKQWGAEFISGDVVRFRVWAEGQQQLTLRLAERDLPMTAVGNGWFQIDVPGVTH
GTEYQFVLQDGMAVPDPASRAQKGDVNGPSVVIDPGRYQPINPDWAGRPWEETVIYELHI
GTFTPQGTFRAAIDKLPYLAELGITQLEVMPVSQFGGSRGWGYDGVLLYAPHSAYGTPED
FHAFIDAAHGLGLSVVLDIVLNHFGPEGNYLPLLSPAFFDAQRMTPWGNGIAYEREPVRH
YILDAPLFWLTEYRLDGLRFDAIDQIKDTASKHILQQIAETIREALPDRHIHLTTEDSRN
VIFLHPRDEKGATPLFTAEWNDDFHNAAHVFATGETHAYYQDFAFEPEKKFARALAEGFV
YQGEVSLQTGHSRGVECHTQPPTFFVDFIQNHDQTGNRAQGERLITLAGADKTRVLLAAL
LLSPHIPLLFMGEEYGETNPFLFFTDFHGDLAKAVREGRAKEFTGHSGHDGDVPDPNDEQ
TFARSKLDWHNVTTAQGKSWLRFTRSLLVLRHRYLVPLLRPGGTVEGKIVKTAPGMVAVS
WSFPTGTLSLALNIGNKPVDVPALAGETLFSWPEAAEVLAPNSIVVRFADGDAS
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggaattcaggacatttcaaaagcagtggggtgctgagtttatttccggtgacgttgta
cgttttcgcgtctgggctgagggacaacaacaacttacgctacgtctggcagaacgcgat
ctgcccatgacggcggtcggtaacggctggttccagattgacgtacctggcgtgacgcat
ggcaccgagtatcagttcgttttacaggacggcatggcggtacctgaccccgcatcgcgg
gcgcagaaaggggacgttaatggcccctccgtggtgattgaccccggccgctatcagccc
atcaacccagactgggcagggcgaccgtgggaagagacggtgatctacgaactgcatatt
ggcacctttacaccgcagggcaccttccgggcggctatcgacaagctgccgtatctggct
gaactcggcatcacccagcttgaagtcatgccggtttcacagttcggcggcagccgcggc
tggggctatgacggcgtattgctatatgctccgcactccgcctatggcacgccggaggat
tttcacgcgttcatcgatgcggcgcacggcctgggcctttctgtcgtgctggatatcgta
ctcaaccatttcggcccggaaggaaactacttacccttgctgtcacccgcgttttttgat
gcgcagagaatgacaccgtggggtaacggtatcgcctatgaacgggagccggtcagacac
tacattcttgacgcgcccctgttctggctgactgaataccgtctggatggcttacggttt
gatgccatcgaccagattaaagatacggcgtcgaaacatattcttcagcagatcgcggaa
acgatccgcgaagcgctcccggatcgtcatatccatctcaccaccgaggacagccgtaac
gtgattttcctgcatcctcgggatgagaagggagccacgccgctgtttaccgccgagtgg
aatgatgatttccacaacgccgcccacgtctttgccaccggcgaaacgcatgcctactat
caggattttgccttcgaaccggaaaaaaaattcgccagagcgctcgcagaaggatttgtc
tatcagggtgaggtctctttgcagaccggacactcacgcggggtggaatgccacacccag
ccgccgaccttctttgtcgattttattcaaaaccacgatcaaaccggtaaccgcgcccag
ggcgaacggcttattaccctggcgggcgcggataaaacccgcgttctgctcgccgcgctg
ctgctgtcaccccatatcccgctgctgtttatgggcgaagagtatggcgaaaccaacccg
ttcctgttctttacggattttcatggcgatctggcgaaagccgtgcgggaagggcgggca
aaagagtttaccggccacagcggacacgatggcgatgtaccggatccgaatgacgagcag
acttttgcccgctcaaaactggactggcacaacgtgacgactgcgcagggtaaatcctgg
ctgcgcttcacgcgaagcctgctggtcctgcggcatcgctatcttgtgccgttacttcgc
cctggcggcaccgttgagggcaaaatcgttaagactgctcccggtatggtggcggtgagc
tggtctttcccgacggggacattgtcgctggcgctgaatatcggtaataagcccgttgac
gttcctgcgctggcaggcgaaacgctctttagctggccggaggccgctgaggtgttagcg
ccgaacagcattgtcgttcgttttgcagatggagacgcatcatga

DBGET integrated database retrieval system