KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01950Help
Entry
ECL_01950         CDS       T01231                                 

Definition
(RefSeq) malto-oligosyltrehalose synthase
  KO
K06044  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00500  Starch and sucrose metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
Module
enc_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECL_01950
Enzymes [BR:enc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     ECL_01950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 9124445
NCBI-ProteinID: YP_003612451
UniProt: A0A0H3CK37
Position
1983886..1986354
Genome map
AA seq 822 aa AA seqDB search
MIPCATYRIQFRNGMTFDRVVELVPYLKDLGISHLYASPIFTATTGSTHGYDVTDPNEID
PAIGGRAGFDRMTAALRQAGMGLILDIVPNHMSTSLENRWWRDVIAFGQQSRYAHYFDID
WSRPLTLPFLGDTFEAELEKGAITLKRDSVTGEAGLVYYDTAYPLNPGTWAAEKSIEAIH
EAQSWRLMSWREAPKQLSWRRFFEITGLVGVRVEDEGVFQDTHRLILELVHTGIVDGLRI
DHIDGLADPLGYLQRLRQATGPDCYITVEKILAKGEQLPVEWPVSGTTGYEFIASLAEVL
VDDNNLGRLEKIHDETLGVTVDRHAELRNAKGLMTDRNFEGEFTTLLNIATDLARCNDID
VPQDDIRYTLRELLIAFPVYRTYGTADGLTAPDVALLNRVVASVDAPEPALSLLVRILTG
DLDASSRDAASLFRTRFQQLTGPLMAKSVEDTLFFRHNLELALNEVGADPTPRAFSLSRF
HQEMRIRLARQPDALLGTSTHDTKRGEDARARLYTLTEAPEQWGENLARWRQMNQTQVRF
LNDGTAPNAADTWMIYQALAGVWPATLSPDDSEGLKSLEARFLGFIEKALREAKQRTDWI
DSNEGYESVVLNYVRHLLSPENTLFLHDFSSSLQPFIRAGLMNSLSQTVIKLTAPGVPDI
YQGSEALNFSLVDPDNRLEPDFATLRQNLSSADAKLFADEQQWRNGRVKQYVTATLLRVR
QHYLSLFQYGDWLPLKVSGEREDNLIVYARVKDGEALIVAVPRLVFATPTNETLWANTSV
VIPEELSGKRYRDQFTGERRALRETLDLTSETGSLLVLLTCE
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgatcccttgtgccacataccgaatacagttccgcaatggcatgacctttgaccgcgtg
gtggagctggtgccataccttaaagacctcgggatcagccatctctatgcctcaccgata
tttaccgccaccaccggttcaacccacggttatgacgttaccgatcctaacgaaatcgat
cctgccattggcgggcgcgccggtttcgaccgcatgacggcggcactcaggcaggcggga
atggggctcattctggacatcgtccctaaccatatgtcgacctcgctggaaaaccgctgg
tggcgggacgttatcgcgtttggtcagcaaagccgttacgcgcactattttgatattgac
tggtcgcgcccgctgacgctgccgttccttggcgacacctttgaggccgagctggagaag
ggggcaattactctgaaacgtgacagtgtcaccggtgaggccgggctggtctactatgac
acagcctatccgcttaaccccggaacatgggctgcggagaaaagcatcgaggcgatccac
gaggcgcagagctggcggctgatgtcctggcgggaagcgccgaaacagctctcatggcgg
cgcttttttgaaattaccggcctggtgggcgtcagagtggaagacgagggggtgtttcag
gatacgcatcgcctgatcctcgagctcgtgcataccggcattgtcgacgggttgcgcatt
gaccatatcgacgggctggccgacccgctgggttacctgcagcggttacgacaggcaacc
ggtcccgactgttatatcacggtggaaaaaattctcgccaaaggggaacaactgcctgtg
gaatggccggtatccggcaccaccggatatgagtttatcgcctcgctggccgaagtgctg
gtcgacgataataacctcgggcggctggaaaaaatccacgacgagacgctgggcgtaacg
gtcgatcgccatgcggaacttcgcaacgctaaagggctgatgaccgatcgcaattttgag
ggtgaattcacaacgctgcttaacattgccaccgaccttgcccgatgcaacgacattgac
gtgccgcaggacgacatacgctacacgctgcgcgaactgctgattgcgtttccggtctac
cgcacctacggcaccgccgacgggttaaccgccccggatgtcgcgctgttgaaccgcgtt
gtcgccagcgtcgacgcaccggaaccggcgttaagcctgttggtgaggatcctcaccggc
gacctggacgccagcagccgcgatgcggcctcgctgttcagaacccgcttccagcagctt
accgggccgctgatggcgaaatcggtggaagatacgctctttttccgccataacctcgag
ctcgccctgaacgaagtgggggccgatcccaccccgcgcgcattctcgttatcccgcttt
caccaggagatgcgcatccgtctggcccgtcagcccgatgcgctgctggggacctccacg
cacgacaccaagcgcggggaagacgcgcgggcgcgcctctacaccctgacggaagccccg
gaacagtggggtgaaaatctggcgcgctggcgacagatgaaccagacccaggtgcgtttt
ctcaatgacggtaccgcgccaaacgcggccgatacctggatgatctaccaggcgctggcg
ggcgtctggcctgcaacgttgtcgcctgacgatagtgaagggctgaagtctctcgaagcg
cgtttcctcgggtttattgagaaagcgctgcgcgaggccaaacagcgtaccgactggatc
gacagcaatgagggctatgagagcgtggtgctgaattacgtccggcacttgctgtcccct
gagaacacgctgttcctgcatgatttctcgtcctccctgcaaccctttatccgcgccggg
ctgatgaacagcctgagccagacggtgatcaaactgacggcgccgggtgtaccagacatc
tatcagggaagcgaggcgcttaattttagcctggtcgacccggataaccggctggagccg
gatttcgccacgctgaggcaaaacctgagcagcgccgacgcaaagctctttgccgacgaa
cagcagtggcgaaacggcagggtgaagcagtatgtcaccgccacgctgttacgcgtccgg
cagcactatttatcgctcttccagtacggcgactggctgccgctgaaggtcagcggcgag
cgcgaggacaacctgattgtctacgcgcgcgtgaaggacggggaggcgctgattgttgcc
gtaccgcgtctggtttttgctacccccacaaacgaaacgctgtgggccaacacttcggtc
gtcatccccgaagagctttccgggaaacgctaccgggatcagtttactggtgaacgtcgg
gcgctgcgggagacgctggatttaacgtctgaaacaggaagtttgttagttctgcttacc
tgcgaataa

DBGET integrated database retrieval system