KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01955Help
Entry
ECL_01955         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2891 KIX
Motif
Other DBs
NCBI-GeneID: 9124450
NCBI-ProteinID: YP_003612456
UniProt: A0A0H3CK40
Position
1990941..1991936
Genome map
AA seq 331 aa AA seqDB search
MELTQHQADAFARMPLTYLRQEYPNHIMHLLNDDGDVLPPRELHPIFYGCFDWHSAVHGY
WLLLRCLRLYPELSCRDDIITLFADHLTPEKVAQELAYFNAPFRASFERPYGYGWLLALA
QELKQSSLPQAAGWYQTLAPLTQDIRNRLVDYLSKLTYPIRVGTHYNTAFALALGIDYAR
AVEDNALESAILEAATRFYLADTQYPAHYEPGGDEYVSGALTEALLMSKVAENFPAWFDA
FLPNIGAVSALMNPAEVSDRTDPKIAHLDGLNLSRAWCMKHIASALPEDHPAQQALRDAV
AKHLKASVGHVVGSHYSGGHWLASFALLALE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaattaacgcaacaccaggctgatgcttttgccagaatgcctttgacctatctgcgc
caggaatacccgaaccacattatgcatctgctcaatgatgacggggacgtcctgccgccg
cgcgaactgcatcccattttttatggctgttttgactggcactcggcggtacacggctac
tggctgctgctgcgctgcttgcgcctctacccggaactgtcgtgccgggatgacattatc
acgctgtttgccgaccatctcacgccagaaaaggtggcacaggagctggcctatttcaac
gcgccgttccgcgcctcgttcgagcgtccgtatggctatggctggctgctggcactggcc
caggagctgaaacagtcatcgctgccgcaggcggcaggctggtatcagacgcttgcgccg
ttaacgcaggacattcgcaaccgtctggtggattacctcagtaagctgacgtacccgatc
cgggttggcacgcattacaacaccgcgtttgccctcgcgctggggatcgattacgcccgg
gcggtggaagataacgcgctggagagtgccattctggaggcggcgacgcggttttatctc
gcggatacccagtatccggctcactatgaaccgggtggtgatgagtatgtgtccggcgcg
ctgacagaggctctgctgatgagcaaggtcgcggagaatttcccggcctggttcgacgcg
tttctgccgaacatcggggctgtttcagcgctgatgaacccggcagaagtgagcgaccgt
accgaccccaaaattgcgcatctggacggattaaacctcagccgcgcctggtgcatgaag
catattgccagtgcgctgccggaggatcatccggcgcagcaggcgctgcgtgatgcggtg
gcgaaacacctgaaggcgagcgtcgggcatgttgtcggcagccactacagcggtgggcac
tggctggcgagttttgcgctgctggcgctggagtaa

DBGET integrated database retrieval system