KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01960Help
Entry
ECL_01960         CDS       T01231                                 

Gene name
cusC
Definition
(RefSeq) copper/silver efflux system outer membrane protein CusC
  KO
K07796  outer membrane protein, Cu(I)/Ag(I) efflux system
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECL_01960 (cusC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enc02000]
    ECL_01960 (cusC)
Transporters [BR:enc02000]
 Other Transporters
  Pores ion channels [TC:1]
   ECL_01960 (cusC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP TPR_MLP1_2
Motif
Other DBs
NCBI-GeneID: 9124455
NCBI-ProteinID: YP_003612461
UniProt: A0A0H3CK44
Position
1996672..1998057
Genome map
AA seq 461 aa AA seqDB search
MFLLKRLSITTVFILTGCVSLAPEYQRPTSPVPQQFSLSRNSLTPVEGMYQDTGWRNFFV
DPQIAGLITEALKNNRDIKMAALKVEEARAQFNVTDADRYPQLNASSGVTYSGGLKSDKP
TSQQYDAGLALSYELDFFGKLKNMSDADRQNFFASEEARRAVHILLVANVSQSYFNQQLA
YKQLRIARDTLSNYQQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEIAKREGELAQAN
NALQLVLGTYRALPGDDGMNASDIAPLTLPPHLSSAILLQRPDIMEAEYQLKAADANIGA
ARAAFFPSISLTSGLSTGSTELSGLFTSGSGMWNFIPKIDIPIFNAGRNKANLKLAEIRQ
QQSVVNYEQKIQSAFKQVADALALRDSLSQQLAAQQRYLDSLNITLQRARGLYTRGAVSY
IEVLDAERALFSTQQNILDLIYARQVNEINLFTALGGGWVE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgctaaaacgactaagcatcactacggtatttatcctgacaggatgcgtctcg
ctggcccctgaataccagcgcccgacgtcaccggtaccccagcagttttcgctgtcgcgt
aacagcctgacgcccgtggagggcatgtatcaggacaccggctggcgcaacttcttcgtc
gatccgcaaatcgcgggattgattacagaggccctgaagaacaaccgcgatataaaaatg
gccgcgctgaaggttgaagaggcccgggcgcagttcaacgtgacggatgcggatcgttat
cctcagctgaacgcctcctcgggcgtcacttacagcggggggctaaagagtgacaaaccc
acctcacagcagtacgacgcgggacttgcgcttagctacgaactcgacttttttggcaag
ctaaagaacatgagcgatgccgaccgacaaaactttttcgccagcgaagaagcccgtcgt
gccgtgcatattttgcttgtcgctaatgtgtcccagagctatttcaaccagcagctggcc
tacaaacagctgcgtatcgcgcgggatacgctgtcaaattatcagcagtcttacgccttc
gttgagcaacagctggtgacgggcagtacgaacgtgctggcgctggaacaggcccggggg
cagatcgaaagtacccgggcagaaattgctaaaagagagggggagctggcacaggctaat
aatgccctgcagctggtcctcggaacgtatcgcgcgctaccgggcgacgacggaatgaac
gccagcgatattgcgccgttaacactgccgccccatctttcatcggcaatattgctgcag
cgcccggatattatggaggcggagtatcagcttaaagcggccgatgcgaatattggcgcg
gcgcgcgctgcctttttcccgtccatctccctgaccagcgggctttcaacgggcagcacg
gaattatctggcctcttcacgtccggcagcggcatgtggaattttattcccaaaatagac
attcccatttttaatgcgggcaggaataaagccaacctgaagctggccgaaattcgccag
cagcagtcggttgtgaattacgaacaaaaaattcagtccgcctttaaacaggtcgccgac
gcgctcgcgctgcgggacagcctcagccagcagcttgctgcgcaacagcggtatcttgat
tcgctaaacatcaccctgcagcgtgccagagggttatatacccgcggtgcggtcagttat
atcgaagtattagacgcggaacgcgcgctgttttccacgcagcaaaacattctcgacctt
atttatgcccgacaggttaatgaaattaatctcttcaccgcgctgggcggcggttgggtc
gaataa

DBGET integrated database retrieval system