KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01963Help
Entry
ECL_01963         CDS       T01231                                 

Gene name
cusA
Definition
(RefSeq) Cu(I)/Ag(I) efflux system membrane protein CusA
  KO
K07787  Cu(I)/Ag(I) efflux system membrane protein CusA/SilA
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECL_01963 (cusA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enc02000]
    ECL_01963 (cusA)
Transporters [BR:enc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ECL_01963 (cusA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran
Motif
Other DBs
NCBI-GeneID: 9124458
NCBI-ProteinID: YP_003612464
UniProt: A0A0H3CIS3
Position
1999690..2002698
Genome map
AA seq 1002 aa AA seqDB search
MIAWIIRRAVANRFLVMMGALFLSVWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQI
VENQVTYPLTTTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDLYWARSRVLEYLNQVQGK
LPAGVSSEIGPDATGVGWIFEYALVDRSGKHDLSELRSLQDWFLKFELKTIPNVAEVASV
GGVVKQYQIQVNPLKLAQYGISLADVKQALGSSNQEAGGSSVEMAEAKYMVRASGYLQTI
DDFNNIVLKTSENGVPVYLRDVARVQTGPEMRRGIAELNGQGEVAGGVVILRSGKNAREV
ITAVKDKLETLKASLPEGVEIVTTYDRSQLIDRAIDNLSYKLLEEFIVVAIVCALFLWHV
RSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGGIAIAVGAMVDAAIVMIENAHKRLEE
WDHQHPSEQIDNATRWKVITNASVEVGPALFISLLIITLSFIPIFTLEGQEGRLFGPLAF
TKTYAMAGAAALAIIVIPILMGFWIRGKIPAESSNPLNRLLIKAYHPLLLRVLHWPKTTL
LVAALSIFTVIWPLSQMGGEFLPKINEGDLLYMPSTLPGVSPAEAAALLQTTDKLIKTVP
EVASVFGKTGKAETATDPAPLEMVETTIQLKPEDQWRPGMTIDKIIEELDKTVRLPGLAN
LWVPPIRNRIDMLSTGIKSPIGIKVSGTVLSDIDATAQSIEAVAKTVPGVVSALAERLEG
GRYIDVDINREKASRYGMTVGDVQLFVSSAIGGETVGETVEGVARYPINIRYPQDYRNSP
QALKEMPILTPMKQQITLGDVADIRVVSGPTMLKTENARPTSWIYIDARGRDMVSVVNDL
KSAISQNVKLRPGTSVLMSLPFALIGGIWFLYWQGFHMSVATGTGFIALAGVAAEFGVVM
LMYLRHAIEANPALSRRETFTAQALDEALYHGAVLRVRPKAMTVAVIIAGLLPILWGTGT
GSEVMSQIAAPMIGGMITAPLLSLFIIPAAYKLIWLRRYKKQ
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatggattatccgacgcgctgtcgccaaccgttttctggtgatgatgggggcg
ctgtttcttagcgtctggggaacatggaccatcatcaatacgccggtggatgccttaccc
gatctgtctgatgttcaggtgattattaaaacgagctaccccggccaggcaccgcaaatt
gtcgaaaaccaggtgacgtatccgctcaccacgaccatgctgtcggtgccgggtgcgaag
accgtgcgtgggttttcacagtttggtgattcctatgtgtacgtcatttttgaagacggg
accgatctctactgggcccgctcgcgcgttctggaatatctcaatcaggttcaggggaag
ctgcctgctggtgtcagttcggaaattgggccagacgctacgggcgtgggctggatcttt
gaatatgcgctggtggatcgcagcggaaaacacgacctgtccgaactgcgttccttgcag
gactggttcctgaaatttgagctgaaaaccatcccgaacgtggcggaggtggcctcggtc
ggcggggtggtaaagcagtatcagatccaggtcaatccgctgaaactggcgcaatacggc
atcagtctggctgacgtgaagcaggccctgggatcctctaatcaggaagcagggggctca
tcggtcgaaatggcggaagcaaagtatatggtccgggccagcggttatcttcagaccatt
gatgatttcaataacatcgtcctgaaaaccagcgagaacggagtaccggtttatctgcgt
gatgtagcccgcgtacaaaccgggcctgaaatgcggcgcgggatcgccgagcttaacggc
cagggagaggtcgcgggcggcgtggtgatcctgcgttcgggtaaaaacgcacgtgaagtg
attaccgcggtaaaagataaactggagacgctgaaggccagcctgccggaaggtgttgag
attgttaccacgtacgatcgcagccagctgattgaccgggccattgataacctgagttat
aaactgctggaagagtttattgtggtggccatcgtctgcgcgctgtttctctggcatgtg
cggtctgcgctggtggcgattatctctctgccgctaggcctgtgtattgcctttatcgtc
atgcatttccaggggctgaacgccaatattatgtccctgggcgggatcgctattgccgtg
ggggcgatggtggatgccgccatcgtgatgattgaaaacgcgcataaacggcttgaggag
tgggatcatcagcaccctagcgagcagattgataacgcgacccgctggaaggtgatcacc
aacgcctccgttgaagtaggccccgcgctgtttattagcctgctgatcatcaccttatcg
ttcatccctatttttaccctcgaaggtcaggaagggcgactgtttggtccgctggccttt
accaaaacgtacgccatggcaggcgcagccgcgctggccattatcgtcattcccattctg
atgggcttctggatccgggggaaaattcctgccgagagcagtaacccgctgaaccggctg
ctgattaaagcctatcatccgctgctgctgcgggtgcttcactggccaaaaacaaccctg
ctggtggcggccttgtcgatcttcacggttatctggccgctgagtcagatgggcggcgag
tttctgccgaagatcaacgaaggcgatctgctgtatatgccatcaacactgccgggcgtt
tctccggctgaagcggctgcgctgttgcagaccacggacaagctcatcaaaaccgttcct
gaagtggcgtctgtgtttggcaagaccggtaaggcagagactgcaacggaccccgcaccg
cttgaaatggtggaaaccaccattcagctgaaacccgaggatcagtggcgacccgggatg
acgattgacaagattattgaagaactcgataaaaccgtccgtctgcccggtctggctaac
ctctgggtgccgccgatccgtaaccgcatcgacatgctttctaccgggattaaaagccca
atcggtatcaaggtgtcaggcaccgttctgtcggatatcgacgccacggcgcagagcatt
gaagcggtcgccaaaaccgtacccggcgtggtgtctgctcttgcagagcggctggaaggg
gggcgttacattgatgtggatattaatcgtgaaaaagcatcccgctacggtatgacggtg
ggggatgtgcagctgtttgtctcctccgccattggtggcgagacggtaggggaaacggtc
gagggcgtggcccggtacccgattaatatccgttatcctcaggactaccggaacagcccg
caggcactgaaagagatgccgatcctgaccccgatgaagcagcaaatcacgctgggggat
gtggcggatatacgtgtcgtttccggcccgacgatgctgaaaacggaaaatgcccgacca
accagctggatctatattgatgcccgcggcagggatatggtgtcggtggtcaatgacctt
aagtcggccatcagccagaacgtgaagctgagaccgggaaccagcgttttgatgagtttg
ccgttcgccctgatcggggggatctggttcctgtactggcagggcttccatatgtctgtc
gccaccggcaccgggtttattgccctggccggggtggccgccgagtttggcgtggtgatg
ctgatgtatctgcgccatgccatcgaagcgaacccggccttatcccgacgggagacattc
accgcacaagcgttggatgaagccctgtaccatggcgcggttctgcgtgtccgacccaag
gcgatgacggtggcggttattattgcgggtttgctgcccatactctggggaaccggcacg
gggtcagaagttatgagtcagatcgccgcgccgatgattggcgggatgatcaccgcgccg
ctgctgtcgctgtttatcattccggcggcgtataagcttatctggttgcgcaggtataaa
aagcaataa

DBGET integrated database retrieval system