KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01965Help
Entry
ECL_01965         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2689 Fer4_17
Motif
Other DBs
NCBI-GeneID: 9124460
NCBI-ProteinID: YP_003612466
UniProt: A0A0H3CK49
Position
2003357..2003668
Genome map
AA seq 103 aa AA seqDB search
MSCEHCRELCVKYVIRTPDQLRKAIRIARNAINEGMLSEVLTKDDWNQYSFSECAEKMIW
GDIVDYHFACNFCGTQFVLGAETYHGSGGYWSPEFEKPSDIID
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcgagcactgccgtgaactctgtgttaagtacgttatccggacgcccgatcag
ttacgaaaagcaattcgtattgccagaaatgcaatcaacgaagggatgttgtcagaagtt
ctgacaaaggacgactggaatcagtacagcttcagtgagtgcgctgaaaagatgatatgg
ggcgacatcgtcgattaccactttgcatgcaacttttgcggtacccagttcgtcctgggg
gcagaaacgtaccatggaagtggaggttactggtcgccagagtttgaaaagccttccgac
atcattgactga

DBGET integrated database retrieval system