KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01968Help
Entry
ECL_01968         CDS       T01231                                 

Definition
(RefSeq) hypothetical protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BTP
Motif
Other DBs
NCBI-GeneID: 9124463
NCBI-ProteinID: YP_003612469
UniProt: A0A0H3CIS8
Position
2006130..2006573
Genome map
AA seq 147 aa AA seqDB search
MEIELDKSFKERVLHAVLFEVTANVIIALSLAWLMNVSVLQSGSLSVISALAATAWNFVF
NKFFDALQKKYAFQRTFLVRAIHAVCFETGLIITLIPVAMVMLNLTVTEAFFVEIGLVLF
FLPYTMLFNWLYDYLRWTFVGRKRSAI
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaactggataaaagttttaaagaacgcgttttgcatgctgttcttttcgaa
gtgacggccaatgtcatcattgcgctgtcacttgcgtggctgatgaacgtgtcggtgctt
cagtcgggttcgttgtccgtgatatctgcacttgccgccacggcatggaattttgtgttt
aataaattctttgacgccttgcagaaaaaatatgcgtttcaacgaacatttctcgtgcgt
gcaatccatgctgtctgctttgaaacaggacttatcattacattaattcctgtcgcgatg
gtaatgctgaatttaacagtcactgaggcattttttgtcgagatcggtctggtactgttt
tttctgccatacacgatgctctttaactggctttatgactacctgcgttggacatttgtt
gggcggaaacggtccgccatctag

DBGET integrated database retrieval system