KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01970Help
Entry
ECL_01970         CDS       T01231                                 

Definition
(RefSeq) MscS mechanosensitive ion channel
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MS_channel
Motif
Other DBs
NCBI-GeneID: 9124465
NCBI-ProteinID: YP_003612471
UniProt: A0A0H3CK53
Position
complement(2006981..2008636)
Genome map
AA seq 551 aa AA seqDB search
MKNNNKLRFRGVEMNKVLLALLSCVLSVISFTGVAAEPRQEPTEQERARTVYIFHQPIVM
LQAKFGLTTPEERVLRIRHTLRNFTQQDVREPLKVVPVTRYNQQGRLIVMNNKPVLLLKQ
ADLDEGDDLTLDQAAQRVLARMEAQRTALRDQYDTGWLALSAGKTVVGLLVLSLFWYGAW
RSWRWVRNVCRRRILENRSVIPQSWRKFVGAIEARLYALLMILLGILGLYLWLSWTFSLF
PWTRVWGASLGDWTMRVLRDIALSIVSAMPGIMIVLIIFVITAFILKLLKVLLNQVEAGR
LQLPGIHPETVGATRKLISVVVWLFALSAAYPFLPGANSLAFKGISVFFGLMLTLGSAGV
MNHAMSGLVLIYSRALRKGDVIRVADNEGLVTEIGMLATKIITRENYVVTVPNAVVVSGK
ITNLSVQNPDGGVNLTIGVTIGYDTPWRQVHAMLEMAARRSKCVDPSQQPLVRQLGLMDW
YIAYELQVKLQPGQSLAEARNELHSNIQDVFNEFNVQIMSPNFVMQPEGAVVVAEENWFA
APAEKPAQKPS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaataacaataagttgcgtttcaggggggtggaaatgaataaggtcctgctcgca
ttattatcctgcgtgctctcggtcatctcatttactggcgtcgccgccgagccacgccag
gagcctactgagcaggagcgggcccgaaccgtttatatttttcatcaaccgattgtgatg
ttgcaggccaaatttggtctcacgacgcctgaagaacgcgtgttacgtattcgccatacc
ttgcgcaatttcacgcagcaggacgtacgtgagccgctgaaagttgttcccgtcacccgt
tacaaccagcagggaagacttattgtcatgaacaataagcctgtattattgcttaagcag
gcggacctggatgagggggacgatttgactctcgaccaggccgctcagcgcgtgctcgcg
cggatggaggcgcaacgtacggcgcttcgcgatcaatatgacaccggctggctggcgctc
tccgccgggaaaacggtcgtcgggctgctggttctgtctcttttctggtacggggcgtgg
cggtcgtggcgctgggttcgcaatgtctgccgtcgccgcattcttgaaaaccgcagcgtt
atcccgcagagctggcgtaagtttgtcggcgcaattgaggctcgtttgtatgctttgctg
atgattttactgggcattctcggattgtatctctggctgagttggacgttcagcttgttc
ccctggacacgcgtctggggtgcatcgttaggcgactggaccatgcgcgtgctgcgggat
attgcgctgtcgattgtctcggccatgccgggaattatgatagtcctgatcatctttgtg
attaccgcctttattctgaagctcctgaaggtgttgttaaatcaggtggaagcagggcgc
ctgcagctgccgggcattcaccctgaaaccgtgggagctacgcgtaaactgatttctgtc
gtggtgtggttatttgccctctctgcggcctatccgtttttaccgggagcgaattcgctg
gcgtttaaaggcattagcgtcttctttggcctgatgcttaccctgggttcggcaggtgtg
atgaaccatgcgatgagcggactggtactgatctactcacgagcgttgaggaaaggagac
gttatacgggtggcggataacgaagggctggtcacggagataggcatgctggcgaccaag
atcatcacccgcgagaactatgttgtgaccgtacccaatgcggtggtggtgagcggaaaa
atcaccaatctgagcgtacagaatcctgacggtggcgtgaacctgacgattggcgtgacg
attggctatgacacgccgtggcgacaggttcatgccatgctggagatggcggcgagacgg
tcgaaatgtgttgacccttcgcagcagcccctggtgcgtcagctggggctgatggactgg
tacattgcctatgagctgcaggtaaaattgcagcccggacagtcacttgccgaagcccgc
aatgagctccacagtaacattcaggacgttttcaacgagttcaacgtgcagatcatgtcg
ccaaacttcgtgatgcagccggaaggtgcggtcgtcgtcgcggaagaaaactggttcgca
gcaccggcagagaaacccgcacaaaagccatcatga

DBGET integrated database retrieval system