KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01974Help
Entry
ECL_01974         CDS       T01231                                 

Definition
(RefSeq) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
Enzymes [BR:enc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     ECL_01974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_23 Methyltransf_31 Methyltransf_11 Methyltransf_12 MTS FtsJ PCMT Methyltransf_2 Ubie_methyltran Methyltransf_32 Methyltransf_33 IlvC
Motif
Other DBs
NCBI-GeneID: 9124469
NCBI-ProteinID: YP_003612475
UniProt: A0A0H3CJR7
Position
2010755..2011513
Genome map
AA seq 252 aa AA seqDB search
MADWNPSLYLQYGAERTRPAAELLARIPLDEVSTIVDLGCGPGNSTALLKHRWPSAHITG
VDNSPAMLEEARQALPDCHFVEADIRQYKPGQPLGLIYANASLQWIPDHYDLLPHLVSLL
KLNGVLAIQMPDNWLEPTHVSMREVAVEQGYPNRGREPLPGVHAYYDILTEAGCDVDIWR
TTYFHKMGSHQAIIDWVSATGLRPWLQELNESERKQFLQRYHELLEEQYPLQENGQILLA
FPRLFIVAQRQP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggccgactggaacccttcgctttatctgcaatacggtgccgaacgcacgcgccctgct
gctgaactgctcgccagaattccactggatgaggtgtccaccatcgttgatttaggctgc
ggaccgggaaacagcaccgcgctgttgaagcatcgatggccttccgcccacatcaccggt
gtcgataactcaccggcgatgctcgaagaggcgcgccaggcgttgcccgattgccacttt
gttgaggccgatattcgccagtacaagccaggccagccgctgggcctgatttatgcgaat
gcctcgctacagtggatccctgaccattacgatctcctgccgcatctggtttcgctgctg
aagctaaacggcgtgctggcgatccagatgcctgataactggcttgaaccgacacacgtc
tcgatgcgcgaagtggctgttgaacaaggttatccgaatcgaggccgtgaacctctgccc
ggtgtccatgcgtattacgatattctgacggaggcaggctgcgacgtggatatctggcgc
acgacctacttccataaaatgggatcgcatcaggcgattattgactgggtcagcgccacg
gggctgcgtccgtggttacaggagttgaatgaaagcgagcggaagcagttcctgcaacgc
taccatgaactgctggaagagcagtatccacttcaggaaaacgggcagatactgctggca
tttccacgcttgtttatcgttgctcaacgtcagccataa

DBGET integrated database retrieval system