KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01975Help
Entry
ECL_01975         CDS       T01231                                 

Definition
(RefSeq) putative cytochrome c biogenesis protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA DsbD Redoxin Thioredoxin_8 Thioredoxin_2 GSHPx Thioredoxin
Motif
Other DBs
NCBI-GeneID: 9124470
NCBI-ProteinID: YP_003612476
UniProt: A0A0H3CK56
Position
complement(2011520..2012710)
Genome map
AA seq 396 aa AA seqDB search
MFLIIAFLGGMISLLSPCTLPVIPLLFAGFQGQRRHILALLAGMIVMFTLVALVATAASN
WIAQATIAGRWVALVVLAIAALALIFPTFAQRIAGPAVSAGNLLNTRSGQTRGTLSAFLA
GLAVGLLWSPCAGPILGAIFSLNIAGHSAIATGALLAAYGSGCALMLGLLVIGGRALMAP
LRARSALMERLRKGAGVVMLATVAFNATGMTSVLKGANGVADRLENSLLTLAKPETAPVK
LQPVVMTEPSSQLPSLSGGTGWVNGDPVTSDSLRGKVVLIDFWTWDCINCQHTLPHVRDW
AKKYQAQGLVVIGVHTPEYPWEKPLASVQKAVTKWQLPYRVVTDNNYKIWNTFGNQYWPA
HYYFDAKGQLRYTSFGEGNYDQQEKVIQQLLKEARS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgataatcgcttttctgggcgggatgataagcctgctcagcccatgtactctc
cccgttattccactgctgtttgccgggttccaggggcaacgacggcatattctggcgttg
ctcgcggggatgattgtaatgttcaccctcgtggcactggtggctaccgccgccagcaac
tggatcgcccaggcgacgatagcagggcgctgggtcgcactggttgtactggcaatagcc
gcactggctcttattttcccgacattcgcccagcgtattgccggaccggccgtcagcgca
ggtaatcttctcaacacacgcagcggacagacgcgcggtactctctccgcatttctggca
gggctggccgtcgggttgctctggtcgccgtgtgccgggccgattctgggtgccatcttc
agcctgaatattgccggtcactccgccattgccacgggggcactgctggccgcttacggc
agcggatgcgcgctgatgctggggctgctggttatcggtggtcgcgcgctgatggcaccc
ctgcgtgccagatcggcattgatggaaaggttacgcaagggggcgggcgtggtgatgtta
gcgaccgttgcgtttaacgccaccgggatgacgtccgttctgaaaggcgccaacggggtc
gcagaccgtctggaaaattcgctcctgacgctggcgaaacccgaaacggcaccggtgaag
cttcagccggtggtgatgaccgagcccagcagccagttaccctccttaagcggcggaaca
ggatgggttaatggtgaccctgtcacgtctgactctctgcgggggaaggtagtattgatt
gatttctggacgtgggactgcatcaactgtcagcatacgctcccgcacgttcgcgactgg
gccaaaaagtaccaggcgcagggtctggtggtaataggtgtgcatacgccggaatacccg
tgggaaaaaccgctcgcctcggtacaaaaagcggtgacgaaatggcagctcccgtatcgg
gtggtcacggataataactataagatctggaacaccttcgggaatcagtactggcccgcg
cactactatttcgatgccaaagggcaactgcgctacacctcctttggcgaaggaaactat
gaccagcaggaaaaagtcattcagcagttgctgaaagaggcccgctcctga

DBGET integrated database retrieval system